KEGG   Shewanella livingstonensis: EGC82_07035Help
Entry
EGC82_07035       CDS       T05875                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
slj  Shewanella livingstonensis
Pathway
slj00620  Pyruvate metabolism
slj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EGC82_07035 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:slj02000]
    EGC82_07035 (oadA)
Enzymes [BR:slj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EGC82_07035 (oadA)
Transporters [BR:slj02000]
 Other transporters
  Primary active transporters [TC:3]
   EGC82_07035 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 PTS_EIIA_1 TAL_FSA
Motif
Other DBs
NCBI-ProteinID: AZG72551
UniProt: A0A3G8LSM1
Position
1622865..1624643
Genome map
AA seq 592 aa AA seqDB search
MSKPLALTDVVLRDAHQSLLATRLRIDDMLPIAPLLDKIGFWSLESWGGATFDSCIRYLG
EDPWDRIRELKKAMPNTPQQMLLRGQNLLGYRHYADDVVTRFVERAHTNGVDVFRIFDAM
NDVRNLETAVKAVKNVGGHAQGTISFTTSPVHSIDTWVDMAKRLEDMGADSLCIKDMAGL
LKPMQAYDLISRLKSQTDLMVSMHCHATTGLSTATYQKAIEAGVDVLDTAISSMSQTYGH
SATETLVAMVEDTDRATGYDMVLLEEIAAYFREVRKKYVRFEGALKGIDSRILRAQVPGG
MLTNMENQLKEQGAADKMDAVLEEIPRVRADLGFLPLVTPTSQIVGSQSVINVLMGERYK
SMTKETEGVLKGEYGATPAPVNAELQARVLKGEQPITCRPADLIAPELDKLRVELAEAAK
EQGFSLAAEQDDDVMTYALFNQIGLKFLKNRGNPDAFEPVPSADDLQVKTDSGPVTYTVN
VEGQRFVVEVSEGGEISHIVSTSATPSVVTSAAVTSATTGEIKCTMAAPLSGNIFKVLVN
NGQTVKMGEVIIILEAMKMETEIRAQEDGVVTQLAVKQGDSVTVGSTLLSLV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccattagcactaaccgatgtagtcctgcgtgacgcacaccaatcattactg
gcaacacgtttacgtattgacgatatgttacccatagcgccgctattagacaaaataggt
ttctggtcacttgaatcatggggcggagccacgtttgactcttgtattcgttatctcgga
gaagacccatgggatcgtattcgtgagctgaaaaaagccatgcctaatacaccgcaacaa
atgttgcttcgtggccagaatctattaggttatcgtcattatgccgacgatgttgttacc
cgttttgtcgagcgcgctcacactaatggggtcgatgtattccgtatttttgatgcgatg
aatgatgtccgcaaccttgaaactgccgttaaagcggttaaaaatgttggcggtcatgcc
caaggtactatttcttttaccacaagccctgttcattcgatagatacttgggttgatatg
gctaagcgtttagaagacatgggcgctgattcattatgtattaaggatatggccggctta
cttaaaccgatgcaagcgtatgacttaattagccgattaaagtcgcaaacggacttgatg
gtatcgatgcattgccatgcgactacaggtttgagtactgcaacgtatcagaaagcgatt
gaagcaggtgttgatgtattggacaccgctatttcatcgatgagccaaacctatggtcac
agcgctacagagactttagtggcaatggttgaagatacggacagagcaaccggctacgat
atggttttgctggaagagattgccgcttattttcgtgaggtacgaaaaaaatatgttcgt
ttcgaaggtgcattaaaaggtatcgactctcgaattttacgtgctcaagtgcctggtggc
atgctaaccaatatggaaaatcaattaaaagagcagggtgcagcagacaaaatggacgca
gtgcttgaagaaattccgcgggtacgcgcagatcttggctttttacctttagttacgcct
acctcgcaaattgtaggttcacagtcagtgattaatgtgctgatgggcgaacgttataag
tcgatgaccaaagaaactgaaggcgtcttaaagggtgaatatggtgctacgccagcgcct
gtgaatgcggaactacaagccagagtgttaaaaggtgagcagcctattacgtgtcgccct
gcagatttaattgcaccagaacttgataagttacgtgtagagcttgctgaagccgccaaa
gagcagggctttagcttagcagcagaacaagatgacgatgtaatgacttacgcgttattt
aatcaaattggtcttaagtttcttaaaaatcgcggtaatccagatgcgtttgagccggtc
cctagtgccgatgatctccaagtaaagaccgatagtggtcctgtaacttataccgttaat
gtcgaaggtcaacgttttgtagtagaagtgagcgaagggggtgagataagtcatattgta
tctacttcagcaacaccttcagtggttacttctgcagcggtaacgtcggcgactaccggt
gagattaagtgcactatggccgcgccactatcaggcaatatttttaaagtgttagttaat
aatggtcaaacagtaaaaatgggtgaagtgattattatccttgaagcgatgaaaatggaa
actgaaattcgcgcccaagaagatggtgttgttactcagttagcggttaagcagggtgac
agtgtcacagtgggttcaacattgttgtcactagtataa

DBGET integrated database retrieval system