KEGG   Shewanella livingstonensis: EGC82_08705Help
Entry
EGC82_08705       CDS       T05875                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
slj  Shewanella livingstonensis
Pathway
slj00430  Taurine and hypotaurine metabolism
slj00620  Pyruvate metabolism
slj00640  Propanoate metabolism
slj00680  Methane metabolism
slj01100  Metabolic pathways
slj01120  Microbial metabolism in diverse environments
slj01200  Carbon metabolism
Module
slj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EGC82_08705
   00640 Propanoate metabolism
    EGC82_08705
  09102 Energy metabolism
   00680 Methane metabolism
    EGC82_08705
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EGC82_08705
Enzymes [BR:slj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     EGC82_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AZG72840
UniProt: A0A3G8LVW9
Position
complement(2014642..2015844)
Genome map
AA seq 400 aa AA seqDB search
MSDKLVLVLNCGSSSLKFAIIDAQSGDDKVSGLAECFGLEDSRIKWKFNGGKNEAKLGAF
TAHREAVEFIVNNILAEHPELAAQIKAVGHRIVHGGEKFTHSVIVTPEVIQGIEDCASLA
PLHNPAHLIGIRAAIASFPNLPQVTVFDTAFHQTMPEKAYIYALPYKLYREHSIRRYGMH
GTSNLYICREAAKVLGKEIKDTNIICAHLGNGASVTAIKGGKSVDTSMGLTPLEGLVMGT
RCGDLDPSIIFHLVKQLGYTLDEVNNLLNKQSGLLGISELTNDCRGIEEGYQDGHKGATL
ALDIFCYRLAKYIASYTVPLGRLDAIIFTGGIGENSDLIREKVLNLLAIFNFKVDDNLNK
AARFGQQGIITQKDSPIAMVIPTNEEWVIAEDAIKLITAK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaattagtactcgtgctcaactgcggtagctcatcattaaaatttgccatc
attgatgcccaatcaggcgatgataaagtttctggattagctgaatgttttggtttagaa
gattcgcgcattaagtggaaatttaatggcggtaagaatgaagccaaattaggtgccttt
actgcgcatcgcgaagcggtagaatttatcgttaataacatcttggcagaacatccagaa
cttgcggcacaaattaaagccgttggtcatcgtatcgtccatggtggcgaaaagtttacc
cactcggttattgttacgcctgaagtcattcagggtattgaagattgtgcatcgttagca
ccactgcataatccggcgcatttaattggtattcgtgccgccatagcctcttttcctaac
ttgccacaagtgactgtgtttgatactgcatttcatcaaaccatgcctgaaaaagcatac
atctatgcccttccttacaaattgtatcgtgaacatagtattcgccgttatggcatgcat
ggtacgagtaatttatatatctgtcgtgaagccgccaaagtactaggtaaagagattaaa
gacaccaatattatttgtgctcacttgggtaatggcgcgtcggtaacggccattaaaggc
ggtaaaagcgttgacacttcaatgggcttaaccccacttgaaggtttagtcatgggtacc
cgttgcggcgatttagacccatcaattattttccatttagttaaacaacttggctatacc
cttgatgaggtcaataacctactaaataagcaaagtggtttactgggtatttcagagctc
accaatgattgtcgtggtattgaagaaggttatcaagacggtcataaaggggctacatta
gctttagatattttctgctatcgtttagccaaatatatcgcctcttacactgtgccatta
ggacgtctagatgccattatctttactggcggcattggcgaaaattcagaccttattcgt
gaaaaagtacttaatttattagcaatctttaacttcaaagttgacgacaacttaaataaa
gcggctcgttttggtcagcaaggtattattacccaaaaagatagccctattgctatggtc
atcccgacaaatgaagagtgggttattgccgaagatgctattaagcttatcacagctaaa
taa

DBGET integrated database retrieval system