KEGG   Shewanella livingstonensis: EGC82_11300Help
Entry
EGC82_11300       CDS       T05875                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
slj  Shewanella livingstonensis
Pathway
slj00860  Porphyrin and chlorophyll metabolism
slj01100  Metabolic pathways
Module
slj_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EGC82_11300
Enzymes [BR:slj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     EGC82_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AZG73298
UniProt: A0A3G8LX79
Position
2638365..2639840
Genome map
AA seq 491 aa AA seqDB search
MNRYKLMVQGTTSDAGKSVMVAGLCRVLARKHFDVAPFKPQNMALNSAVTIEGGEIGRAQ
AVQAQAAGLKPSILMNPVLLKPNTDTGAQVIVRGKVLSDMDAREYHAYKPKLLAMVVETF
DDLGKQFEHRIIEGAGSPAEINLRDNDIANMGFAEAVDAKVVIIADIDRGGVFAHLYGTY
ALLSPTEQARVCGFIINRFRGDPSLLDSGLTWLTEKTGVPVLGVIPYLKGLYLEAEDAIN
VQQTDGDAHFKVVVLGLPRISNHTDFDALRLHPKVDLTFVRPGDQWPNADLIIVPGSKST
RGDLAALRTQGWDKQIARHLRFGGKVIGICGGYQMLGNKISDPNGVEGPAGECLGLGYLN
IDTRLQGTKQLKQVCGTVEINGKKATISGYEIHVGESHSNDLQPFTLNGVKDGAISSCGN
ILGGYLHGMFDDPDACNLLLHWAGLETAHSQASDMDQLREAGLDRVADAIEAHLDLDTLF
ADIRGSLSWKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttataaattaatggtgcagggcaccaccagtgatgcgggtaaaagtgtcatg
gttgcggggttatgtagagtattagcccgtaagcattttgatgtggcaccgtttaaaccg
caaaatatggcattaaatagtgccgtcactattgaaggcggagaaattggccgtgcccaa
gctgttcaggcacaggcagctggtcttaaacccagtattctaatgaatccggtattgctt
aaacccaatactgacactggtgctcaagtgattgttcggggcaaagtattatcagatatg
gatgcgcgagaataccatgcctacaaacctaagctgttggctatggtggttgaaaccttt
gacgatctcggtaaacaatttgaacatcgcattatcgaaggtgctggcagtccagcagag
ataaatctacgtgataacgacattgccaatatgggttttgcggaagctgttgatgcaaaa
gtggtcattattgctgacatagatcgcggcggtgtatttgcccatttgtatggcacatac
gcattattgtcgccaactgaacaggctagggtatgcggatttattatcaatcgctttaga
ggtgatccaagtttattggattcaggcttaacctggctaacagaaaaaaccggcgtgcct
gtactgggtgttataccttatttaaaaggattatacctagaggctgaagacgctattaat
gtgcagcaaactgatggtgatgcgcactttaaagtcgttgttttgggtttgcctcggatc
agtaatcacactgacttcgatgctttgcggcttcatccaaaagtcgacctcacttttgta
cgccctggcgatcaatggcctaatgccgatttaattattgttcctggttctaaaagtacc
cgtggcgacttagccgcgttgcgtactcaaggttgggacaaacagattgcaaggcatctg
cgttttggtggaaaagtcattggcatttgtggtggttatcaaatgttgggcaataaaatt
tcggatcccaatggcgtagaaggtcctgccggggagtgtttaggtttaggttacctcaat
atagacaccagattacaaggaacaaaacaacttaaacaagtctgtggaaccgtagaaatt
aacggtaaaaaagccactatatcgggttacgaaatccatgtaggcgaaagccattccaac
gacttacaaccttttacactcaatggcgtaaaagatggtgctatatcaagttgtggaaac
atacttggtggctatttacatggcatgttcgatgatcctgacgcgtgtaatttattgctt
cattgggcaggtcttgaaaccgctcattctcaagcatccgatatggatcaattaagagaa
gcaggattagacagagttgctgacgctatagaggcacacctcgatcttgataccttattt
gccgacattagaggatcactgtcatggaaaaagtaa

DBGET integrated database retrieval system