KEGG   Shewanella livingstonensis: EGC82_14645Help
Entry
EGC82_14645       CDS       T05875                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
slj  Shewanella livingstonensis
Pathway
slj00270  Cysteine and methionine metabolism
slj00920  Sulfur metabolism
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
slj01130  Biosynthesis of antibiotics
slj01230  Biosynthesis of amino acids
Module
slj_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EGC82_14645
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EGC82_14645
Enzymes [BR:slj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     EGC82_14645
    2.3.1.46  homoserine O-succinyltransferase
     EGC82_14645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AZG73886
UniProt: A0A3G8LW52
Position
complement(3392120..3393064)
Genome map
AA seq 314 aa AA seqDB search
MPVRIPDNLPAAGILESENIFVMSETRAANQDIRPMRVLILNLMPNKIETETQLLRLLGN
TPLQVGVDLLRIHDKESKHTSVDHMNTFYRDFEDIRHNNYDGLIITGAPLGQVDFKDVVY
WDHIREIIDWSQQHVTSVLFLCWAAHAGFYHLYDLQRKLLANKRSGVFNHRRTSDPHPLL
RGFDDEFFAPHSRFAEMDIEQIRQHPDLEVLAESDEAGAYIVLSRDNHNVFVMGHPEYQK
DTLNEEYVRDMGLGLRPDIPQNYYRQDDPNQDPVVRWHSHGSLLVSNWLNYYVYQLTPYD
LSDMNAKTPWENKK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccggttcgaattccagataacctgccagcagcaggcattttagagtcagaaaatatc
tttgtgatgtctgaaacccgtgcggctaatcaggacattcgtccaatgcgggtattaatc
ttgaatttaatgcctaataaaattgaaacagaaacccagttattacgtttactcggcaat
accccattacaggttggagtcgatttattacgcatacatgataaagaatcaaagcacact
tcagttgatcacatgaacaccttttatcgtgattttgaagacatcagacataacaattac
gatggcctgatcattacaggggctccgctagggcaagttgactttaaagatgtggtctat
tgggatcatattcgcgaaattattgattggtcacaacaacatgtgacatcggtattattt
ttgtgctgggctgctcatgcgggtttttaccatctttatgatttacagcgcaaattatta
gccaacaagcgttcaggtgtgtttaatcatcgtcgtaccagcgatccacacccattatta
cgtggttttgatgatgaattttttgcgcctcattcacgatttgcagaaatggacattgaa
caaattcgccaacatcctgatttagaagtgttagctgaatctgatgaagctggggcgtat
attgtgctcagtcgcgataaccataatgtgtttgtaatgggccaccctgaatatcaaaaa
gacaccttgaacgaagaatatgtgcgcgatatggggttagggcttaggcctgatattcca
caaaattattatcgacaagacgatcctaatcaagaccctgttgtacgctggcacagccat
ggtagcttattagtcagtaactggctcaactattatgtttatcagctaaccccttatgac
ttgtcggacatgaatgccaaaacgccatgggaaaataaaaagtaa

DBGET integrated database retrieval system