KEGG   Shewanella livingstonensis: EGC82_18930Help
Entry
EGC82_18930       CDS       T05875                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
slj  Shewanella livingstonensis
Pathway
slj00564  Glycerophospholipid metabolism
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
Module
slj_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EGC82_18930 (psd)
Enzymes [BR:slj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EGC82_18930 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AZG74638
UniProt: A0A3G8M0X8
Position
4351476..4352342
Genome map
AA seq 288 aa AA seqDB search
MDSIKIALQYMLPKHFLSRLVGKFAAAEAGIITTVGIKWFIKKYKIDMSEAQQPEPEAYK
TFNAFFTRALKPELRPINQDGTMMAHPVDGAVSQCGPIEAGNIFQAKGHTYTAEALLGGD
KVDAARFDGGDFATIYLAPKDYHRIHMPITGTLSKMTYVPGDLFSVNPLTAQNVPGLFAR
NERVVALFETEVGPLAMVLVGATIVASIETIWSGTVTPPGGKQVFSWDYPTTGPDAVTLE
KGAEMGRFKLGSTVVMLFAQDAIETFADGVEPGETTRMGQPFAMLSKA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggactcaattaaaattgccttgcagtacatgctgccaaaacactttttgtcgcgttta
gtcggtaaatttgctgctgctgaagcaggcattattaccacagtagggatcaaatggttt
atcaaaaaatacaaaattgatatgtcagaagcacagcaacctgagcccgaagcctataaa
acctttaatgccttttttactcgtgcgctaaagcctgaacttagaccgataaaccaagac
ggtactatgatggcacatccggtagatggagcagttagtcagtgtggccctattgaagct
ggtaatattttccaagccaaaggtcacacctacaccgctgaagcgttattaggtggtgat
aaggttgatgctgcacgttttgatggtggtgattttgccaccatttatttagcaccaaaa
gattatcaccgcattcacatgccaatcaccggcacattatcgaaaatgacttatgtccca
ggtgacttgttttcggttaatccacttaccgcgcaaaatgtaccaggattgtttgcccgt
aatgaacgtgtagtggctctatttgaaacagaagtaggtccacttgcaatggtactggtt
ggtgcaaccatagttgccagtattgaaaccatatggtccggcacggtaacaccgccaggt
ggtaaacaagtgtttagctgggactacccaactacaggtccagatgcggttaccttagaa
aagggcgctgaaatggggcgctttaaattaggtagcactgtagtgatgctatttgcacaa
gatgccatagaaacatttgcagatggtgtagagccgggtgaaacaacgcgtatgggccag
cctttcgctatgctgtctaaagcgtaa

DBGET integrated database retrieval system