KEGG   Stenotrophomonas sp. LM091: BIZ42_02710Help
Entry
BIZ42_02710       CDS       T04630                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00480  Glutathione metabolism
slm00590  Arachidonic acid metabolism
slm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BIZ42_02710
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BIZ42_02710
Enzymes [BR:slm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BIZ42_02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin PsaX AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AOX61199
UniProt: A0A1D8Y6Q1
Position
complement(606905..607513)
Genome map
AA seq 202 aa AA seqDB search
MHHVSLLSPIRCGRIPRRARWSVLLLAAGLLVGASAQAADLLDVSYRPLAGKGEVNLAKQ
YGGKVLLVVNTASKCGFTPQYEGLEALQRKYAARGFSVLGFPSNDFKGQEPGDEAQIQEF
CTLTYGVKFPMFQKVVVTGPEATPLYRSLATATGVSPGWNFHKYLISRDGRVVAQFPSKV
TPDDPKLVAAIERELSVTANKH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcatcacgtgtctttgttgtcgcccatccgctgcggccgcattccgcgccgggcgcgg
tggtccgtgttgttgctggcggccggcctgctggtgggcgcctcggcccaggcggccgat
ctgctggatgtgagctatcgcccgctggccggcaagggcgaggtcaatctggccaagcag
tacggcggcaaggtgctgctggtggtcaacaccgccagcaagtgcggattcaccccgcag
tacgaaggcctggaagcgctgcagcgaaagtacgccgcgcgtggtttctcggtgctgggc
ttcccgtccaatgacttcaagggccaggagccgggtgacgaagcccagatccaggagttc
tgcacgctgacctatggcgtcaagttcccgatgttccagaaggtggtcgtcaccgggccg
gaggcgacgccgttgtatcgcagcctggccacggccacgggcgtgtcgcccggctggaac
ttccacaagtatctgatcagccgcgatggccgggtggtggcgcagttcccgagcaaggtc
acgccggacgacccgaaactggtcgcggcgatcgaacgtgaactgtctgtcacggccaac
aagcactga

DBGET integrated database retrieval system