KEGG   Stenotrophomonas sp. LM091: BIZ42_10190Help
Entry
BIZ42_10190       CDS       T04630                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00071  Fatty acid degradation
slm00072  Synthesis and degradation of ketone bodies
slm00280  Valine, leucine and isoleucine degradation
slm00310  Lysine degradation
slm00362  Benzoate degradation
slm00380  Tryptophan metabolism
slm00620  Pyruvate metabolism
slm00630  Glyoxylate and dicarboxylate metabolism
slm00640  Propanoate metabolism
slm00650  Butanoate metabolism
slm00900  Terpenoid backbone biosynthesis
slm01100  Metabolic pathways
slm01110  Biosynthesis of secondary metabolites
slm01120  Microbial metabolism in diverse environments
slm01130  Biosynthesis of antibiotics
slm01200  Carbon metabolism
slm01212  Fatty acid metabolism
slm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BIZ42_10190
   00630 Glyoxylate and dicarboxylate metabolism
    BIZ42_10190
   00640 Propanoate metabolism
    BIZ42_10190
   00650 Butanoate metabolism
    BIZ42_10190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BIZ42_10190
   00072 Synthesis and degradation of ketone bodies
    BIZ42_10190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BIZ42_10190
   00310 Lysine degradation
    BIZ42_10190
   00380 Tryptophan metabolism
    BIZ42_10190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BIZ42_10190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BIZ42_10190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BIZ42_10190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slm04147]
    BIZ42_10190
Enzymes [BR:slm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BIZ42_10190
Exosome [BR:slm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BIZ42_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOX62547
UniProt: A0A1D8YAD6
Position
2349820..2351100
Genome map
AA seq 426 aa AA seqDB search
MPNARSVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSSDWNLGREATLSSGLSPLTPGITMQRACGTSLDTIIAVANKIALGQIDSGIGGGSDT
TSDVPIVYGKKLRARLLAANRAKSTGDKLKALTRGFKLSELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRADTSLEKL
ATLKPAFDKVSGRGTLTAANSTPLTDGASAVLLASEEWARAHGHEPLAYLRDSQVAAVDF
VHGEGLLMAPTIAVPEMLKRNGLTLQDFDLYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
EAPLGKIDPAKINPLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgcccgttccgtcgccatcctcggcggcgtccgcattccgttctgtcgccag
aacacggcttattcggacgtcggcaatctcggtatgtcggtgcgcacactcggtgcgctg
gtcgagcgcttcggcctgcacggccagcagctgggcgaagtggcgatgggcgcggtgatc
aagcactccagcgactggaacctgggccgcgaagcaacgctgtcctcgggcctgtccccg
ctgaccccgggcatcaccatgcagcgtgcctgcggcacctcgctggataccatcattgcg
gtggccaacaagatcgcgctgggccagatcgactcgggcatcggtggcggctcggacacc
acctccgatgtgccgatcgtctacggcaagaagctgcgtgcgcgcctgctggcggccaac
cgcgccaagagcaccggcgacaagctcaaggcactgacccgcggcttcaagctgagtgaa
ctcaagccggaattcccgggcgtggccgagccgcgtaccggcaagagcatgggcgaccac
tgcgaagacatggccaaggagtggaacatctcccgcgactcgcaggatgagtgggcggtg
tcctcgcacaagaagctggccgccgcgtacgagcgcgggttcttcaacgacctgatcgcg
ccgttccgcggcgtggagcgcgacaacatcctgcgcgccgatacctcgctggaaaaactg
gccacgctgaagccggccttcgacaaggtctccggccgcggcacgctgaccgccgccaac
tccaccccgctcaccgacggcgcctcggcggtgctgctggccagcgaagagtgggcgcgc
gcgcatggccacgagccgctggcgtacctgcgtgattcgcaggtggcggccgttgatttc
gtacacggcgaaggcctgctgatggcgccgaccatcgcggtgccggagatgcttaagcgc
aatggcctgaccctgcaggatttcgatctctacgaaatccacgaggccttcgctgcacag
gtgctgtgcacgttgcgcgcgtgggaaagcgaagactactgccgcaaccggctgggcctg
gaggcgccgctgggcaagatcgatccggccaagatcaatccgctgggctcctcgctggcc
accggccacccgttcgccgccaccggcgcccgcgtgatcgccacggcggccaagcagctg
gccgaacgcggcggtggccgcgcgctggtctcgatctgcaccgccggcggcatgggcgtg
gtggcgatcgtcgagcgctga

DBGET integrated database retrieval system