KEGG   Stenotrophomonas sp. LM091: BIZ42_10330Help
Entry
BIZ42_10330       CDS       T04630                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
slm  Stenotrophomonas sp. LM091
Brite
KEGG Orthology (KO) [BR:slm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slm03016]
    BIZ42_10330
Enzymes [BR:slm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BIZ42_10330
Transfer RNA biogenesis [BR:slm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BIZ42_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOX64279
UniProt: A0A1D8YFK7
Position
2380909..2381655
Genome map
AA seq 248 aa AA seqDB search
MSAIELQAEAIAEAPVALPPLQLLHLDDQLAVVNKPAGLMVHDSKLARGEDDFLADRLRE
QLGKPIFLVHRLDRATSGCLLLAFDRESASVLGKSLMGGDVTKDYLAICRGWPADEAFTV
DHDLDGGPGKPVKKQAITHFQRVAVGEIAIPMGGFETSRYALLRCQPQTGRFRQIRRHLK
HLSHHLIGDTSHGDGRHNRSFRMQGIHRMLLHAERLRFPHPNGTPMDISAPVDGEFRKAM
DLFGWDVR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatcgaactgcaggccgaggccatcgccgaggcgcctgttgcgcttccgccc
ctgcaactgctgcacctggacgaccagctcgccgtggtcaacaagcccgccgggctgatg
gtccacgacagcaagctcgcccgcggcgaagacgacttcctcgccgaccgcctgcgcgaa
cagctcggcaagccgatcttcctcgtccaccgcctggaccgcgccaccagcggctgcctg
ctgctcgcctttgatcgcgaaagcgccagcgtgctcggcaaatcgctgatgggtggcgac
gtcaccaaggattatctggcgatctgccgtgggtggccggccgacgaggcctttaccgtc
gaccatgacctggatggcggccccggcaagccggtcaagaagcaggcgatcacccacttc
cagcgcgtcgccgtgggcgagatcgccattccgatgggcgggttcgagacctcacgttac
gccctgctgcgctgccagccgcagaccggccggttccgtcagatccgccgccacctcaag
cacctctcgcatcacctgatcggcgacaccagccacggcgacggtcgccacaaccgcagc
ttccgcatgcagggcatccaccgcatgctgctgcacgccgagcgcctgcgcttcccgcat
ccgaacggcacgccgatggacatcagcgcgccggtggacggggaattccgcaaggcgatg
gatctgtttggttgggacgtgcgatag

DBGET integrated database retrieval system