KEGG   Stenotrophomonas sp. LM091: BIZ42_16510Help
Entry
BIZ42_16510       CDS       T04630                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
slm  Stenotrophomonas sp. LM091
Brite
KEGG Orthology (KO) [BR:slm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BIZ42_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-ProteinID: AOX63652
UniProt: A0A1D8YDK3
Position
3710315..3711436
Genome map
AA seq 373 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAFMNLIGALTGTAV
ALTIASGLLNTNVVDVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNNWDALIWSERIGTWAQNKGLLWKVFLPMITSPIAGFLLGIAVMLLLWAIIAGMAKVGG
FIGRLARPRIVNAFFGKAQIASAAYMGFAHGHNDAQKTMGIIAMTLIGAEATGALNDLPS
WLAFMHPDASAGDGIAMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAETS
SATILTLAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRFGVIERIVWAWILTIPAAGGCA
YLILRLFELFGWA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccttgtcctggtggtgatcctggccgcgctcgttttcgagttcatcaacggc
ttccacgataccgccaactccatcgccaccgtggtggcgaccaaagtgctctcgcccggc
tgggcggtgatgctcgccgcgttcatgaacttgatcggcgcgctgacgggcaccgccgtc
gcgctgaccatcgcctcgggcctgctcaacaccaacgtggtcgatgtgaccccgcaggtg
atcctgtgcgcgctgctgggcggcatcatctggaacctgatcacgtggtggaagggactg
ccgtcctcgtcctcgcacgccctgatcggcggcctgtgcggcgccggcctggccgcggcc
cataacaactgggacgcgctgatctggtccgagcgcatcggcacctgggcccagaacaag
ggcctgctgtggaaggtgttcctgccgatgatcacctcgccgatcgccggcttcctgctc
ggcatcgcggtgatgctgctgctgtgggcgatcatcgcgggcatggccaaggtcggcggg
ttcatcggccggctggcgcgcccgcgcatcgtcaatgcgttcttcggcaaggcccagatc
gcctcggcggcctacatgggcttcgcccacggccacaacgatgcgcagaagaccatgggc
atcatcgccatgacgctgatcggtgccgaagccaccggtgccctgaacgacctgccgtcc
tggctggccttcatgcacccggacgcgagcgccggcgacggcatcgccatgtggatcgtg
ctgacctgcgccgtggtgatggccgccggtaccgcctcgggcggctggaagatcatcaag
accctgggccacaagatggtcaagctgcacccgatccacggcttcgccgcggaaaccagc
tcggccaccatcctgaccctggccgcgcacttcggtatgccggtctcgaccacccacagc
atctccaccgcgatcatgggcgtgggcttcgccaagaacccgcgttcgctgcgcttcggc
gtgatcgagcgcatcgtgtgggcgtggatcctgacgatcccggccgccggcggttgtgcg
tacctgatcctgcgcctgttcgaactgttcggctgggcctga

DBGET integrated database retrieval system