KEGG   Stenotrophomonas sp. LM091: BIZ42_17055Help
Entry
BIZ42_17055       CDS       T04630                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00430  Taurine and hypotaurine metabolism
slm00460  Cyanoamino acid metabolism
slm00480  Glutathione metabolism
slm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BIZ42_17055
   00460 Cyanoamino acid metabolism
    BIZ42_17055
   00480 Glutathione metabolism
    BIZ42_17055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slm01002]
    BIZ42_17055
Enzymes [BR:slm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BIZ42_17055
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BIZ42_17055
Peptidases and inhibitors [BR:slm01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BIZ42_17055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AOX63749
UniProt: A0A1D8YE19
Position
3821967..3823703
Genome map
AA seq 578 aa AA seqDB search
MRTLSRRWLLLVLLVAPSAWAAESAPAVLAKHPDGAAVASGHHLATEAGMEILAKGGNAF
DAAVAVSATLAVVEPISSGLGGGGFFLLHDAATGKDVMLDARETAPQSATPEAFLDKKGD
LDRDRSVNGAWSAGIPGLPAALVELSSRHGKLPLKTSLEPAMRIARDGFPVYARMSKGYQ
SRREVMQRYPGTREVYERNGKPIAEGDLFRQPELAKTMERLADQGFDGFYRGETGKLLLK
GVKQAGGHWTAEELAGYRVKLREPIAFKYRDWTITTASPPSSGGIALAAMLQILEGWDLK
SMDPAHRTHLVVEAMRRAYRDRTFFLGDPDFVDIPQKVLTSKDYAQGLRATIHPDKATPS
DLLSGNPTPLEDDETTHFSIIDREGNRVGATQTVNLLYGSGLIPSGTGVLLNNEMDDFAL
KPGTPNAFGVMGYAANAPKPGKRMLSSMTPTFMESADKVVVLGTPGGSRIITMVLLGILG
YDDGLTAQQVAALPRYHHQWLPDLIEAEDGTFDVGTIKQLQAMGHKIDLPGDTAAGGRGS
SHVWGNLQTVEWDRRSNVLSGGSDPRNPVGSAAVSQAH
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctgtcgcgtcgttggttgctgctcgtcctgctggtggccccgagtgcctgg
gccgcggaatccgcaccggcggttctggccaaacaccctgacggcgccgccgtcgccagt
ggccatcatctggccacggaagcgggcatggagatcctggccaagggcggcaacgcgttc
gacgccgccgtggccgtgtctgccacgctggcggtggtcgagccgatcagctcgggcctc
ggcggcggtggattcttcctgctgcacgatgcggccaccggcaaggacgtgatgctggac
gcgcgcgaaaccgcgccgcagtccgccacgcccgaggcgtttctcgacaagaagggtgac
ctggaccgcgaccgttcggtcaacggcgcgtggtcggccggtatcccgggcctgccggcc
gcgctggtggaactgtcctccaggcacggcaagctgccgctgaagacctcgctggagccg
gcgatgcgcatcgcgcgcgatggcttcccggtgtacgcgcgcatgtccaagggctatcag
tcccggcgtgaggtgatgcagcgctaccccggcacgcgcgaggtctacgagcgcaacggc
aagccgatcgccgagggcgacctgttccgccagccggaactggccaagaccatggagcgc
ctggccgaccagggcttcgatggcttctaccggggcgagaccggcaagctgctgctcaag
ggcgtgaagcaggccggcggacactggaccgccgaggaactggccggctaccgggtcaag
ctgcgcgagccgatcgccttcaagtaccgcgactggaccatcaccaccgcctcgccgccg
tcgtccggtggcatcgcgttggccgccatgctgcagatcctggaaggctgggacctgaaa
tcgatggatccggcgcaccgcacccatctggtggtggaagccatgcgccgcgcctaccgc
gaccgtaccttcttcctgggcgatccggatttcgtggacatcccgcagaaggtgctgacc
agcaaggattacgcgcagggcctgcgtgccaccatccacccggacaaggccacccccagc
gatctgctgtcgggcaacccgaccccgctggaagatgacgagaccacccatttctcgatc
atcgaccgcgaaggcaaccgcgtcggcgcgacccagaccgtgaacctgctatacggctcg
ggcctgattccgtccggcaccggcgtgctgctcaacaatgaaatggacgatttcgcgctg
aagccgggcacgccgaacgccttcggcgtgatgggctatgcggccaatgcgcccaagccg
ggcaagcgcatgctcagctcgatgaccccgaccttcatggagtccgccgacaaggtcgtg
gtgctcggcacgcccggtggcagccgcatcatcaccatggtgctgctgggcatcctgggg
tacgacgacggcctgaccgcccagcaggtcgccgcgctgccgcgctaccaccaccagtgg
ctgccggacctgatcgaggccgaggacggtaccttcgatgtgggcaccatcaagcagctg
caggcgatgggccacaagatcgacctgcccggcgataccgcagctggcggccgcggttcc
agccacgtctggggcaacctgcagaccgtggaatgggaccgtcgcagcaacgtgctcagc
ggcggcagcgacccgcgcaatccggtcggcagcgccgcggtcagccaggcgcactga

DBGET integrated database retrieval system