KEGG   Stenotrophomonas sp. LM091: BIZ42_17640Help
Entry
BIZ42_17640       CDS       T04630                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00230  Purine metabolism
slm00240  Pyrimidine metabolism
slm01100  Metabolic pathways
slm01110  Biosynthesis of secondary metabolites
slm01130  Biosynthesis of antibiotics
Module
slm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
slm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
slm_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BIZ42_17640
   00240 Pyrimidine metabolism
    BIZ42_17640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slm04131]
    BIZ42_17640
Enzymes [BR:slm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BIZ42_17640
Membrane trafficking [BR:slm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BIZ42_17640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AOX63856
UniProt: A0A1D8YE35
Position
3949489..3949914
Genome map
AA seq 141 aa AA seqDB search
MALERTLSIIKPDAVAKNVIGEIYARFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF
NALVEFMISGPVMIQALEGENAVLAHRDLLGATNPKEAAAGTIRADFAESIDANAAHGSD
SVENAAIEIAYFFAATEVVSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggagcgcaccctttccatcatcaagccggacgccgtcgccaagaacgtcatc
ggtgaaatctacgcccgcttcgaaaaggccggcctgaaggtcgtcgccgccaagtacaag
cagctgtcgcgccgtgaagccgaaggcttctacgccgtgcaccgcgagcgtccgttcttc
aacgcgctggtcgagttcatgatctccggcccggtgatgatccaggcgctggaaggcgag
aacgccgtgctggcccaccgcgacctgctgggcgccaccaacccgaaggaagccgccgca
ggcaccatccgcgccgacttcgctgaatccatcgatgccaatgccgcccacggctcggac
tcggttgagaatgccgcgatcgaaatcgcttatttcttcgccgcgactgaagtcgtctcg
cgctga

DBGET integrated database retrieval system