KEGG   Staphylococcus lugdunensis N920143: SLUG_04430Help
Entry
SLUG_04430        CDS       T01951                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00071  Fatty acid degradation
sln00072  Synthesis and degradation of ketone bodies
sln00280  Valine, leucine and isoleucine degradation
sln00310  Lysine degradation
sln00362  Benzoate degradation
sln00380  Tryptophan metabolism
sln00620  Pyruvate metabolism
sln00630  Glyoxylate and dicarboxylate metabolism
sln00640  Propanoate metabolism
sln00650  Butanoate metabolism
sln00900  Terpenoid backbone biosynthesis
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
sln01212  Fatty acid metabolism
sln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLUG_04430 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SLUG_04430 (thl)
   00640 Propanoate metabolism
    SLUG_04430 (thl)
   00650 Butanoate metabolism
    SLUG_04430 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLUG_04430 (thl)
   00072 Synthesis and degradation of ketone bodies
    SLUG_04430 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLUG_04430 (thl)
   00310 Lysine degradation
    SLUG_04430 (thl)
   00380 Tryptophan metabolism
    SLUG_04430 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLUG_04430 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLUG_04430 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SLUG_04430 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sln04147]
    SLUG_04430 (thl)
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SLUG_04430 (thl)
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLUG_04430 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCB52878
Position
487855..489009
Genome map
AA seq 384 aa AA seqDB search
MRNIAIVSAKRTPIGRYKGKLRDYSAVELGTAALKAAVEAIDIDPSTIQQVIFGNVLQSG
VGQNPARQIAIKAGLPNTTPAMTINEVCGSGLKAIILGKQLIQLGEAKVVAVGGVESMTN
APQLILKEGQDPVESFMHDGLTDAFHYVPMGVTAENIAEKYHISREMQDAFANQSQQKAH
QATINGKFNNEIVPLIDAEGNEMTSDEGIRANSSVEKLATLKTIFKEQGTVTGGNASSIN
DGSSALILMEESYAKAHGFEILGLIGDYAEVGCDPQYMGYAPFYAVEKLLEKTQRHIDQV
DIVEMTEAFAAQSIPVKDNLHIPDDKLNIYGGAIALGHPIGASGARLVTTLVNALAQEEK
QTGVATACIGGGLGIALMIEKGES
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattgcaatcgttagtgctaaacgcacaccaattggaagatacaaaggtaag
ttacgagactattcagcagttgaactaggaacagcagctttaaaagcagcagtagaagct
attgatattgatccaagtacaattcaacaagtcatttttggtaacgttcttcaaagtggg
gttggtcaaaatccagcacgtcaaattgctattaaagctgggttacctaacacgacaccg
gcaatgacaataaacgaggtatgtggttcaggccttaaagcaattattttaggcaagcaa
ttaatacaattaggcgaagcaaaagttgtggcagttggtggtgttgaaagtatgacaaat
gcaccacagttgattttaaaagaaggacaagaccctgtagaaagttttatgcatgatggt
ttaaccgatgctttccattatgttccaatgggtgtgactgctgaaaacattgcagaaaaa
tatcatattagtcgagaaatgcaagatgcgttcgctaatcaatcacaacaaaaggcgcat
caggctacaataaatggaaaatttaataatgaaatagtgcctctaatcgatgctgaaggt
aatgaaatgacttcagatgaaggtattcgtgctaatagtagtgttgagaaattagctacg
ttaaaaacaatatttaaagagcaaggtacggtcacaggtggcaatgcttctagtataaat
gatggatcgtctgcacttatcttgatggaagaaagttatgctaaagcacatggattcgag
atacttggcttgataggtgactacgctgaagttggttgcgatccacaatatatgggctat
gctccattctatgctgttgaaaaattattagaaaaaactcagcgtcatattgatcaagta
gatattgtagaaatgacagaggcgtttgcagcacaaagtattccagttaaagataatttg
catattccggatgataaattaaatatatatggtggtgcaattgcacttggtcatccgatt
ggcgcaagtggtgcaaggttagtgacaacattggtaaacgcattggcgcaagaagaaaag
caaacgggtgtagctactgcttgtattggtggcggcctaggtattgcgctaatgattgaa
aaaggggaatcataa

DBGET integrated database retrieval system