KEGG   Staphylococcus lugdunensis N920143: SLUG_05410Help
Entry
SLUG_05410        CDS       T01951                                 

Definition
(GenBank) zinc dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLUG_05410
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SLUG_05410
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SLUG_05410
    1.1.1.-  
     SLUG_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C MTS UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CCB52988
Position
complement(598450..599502)
Genome map
AA seq 350 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKVLKDNEVKVKVSWTGICGTDLHEYLEGPVFISTEQPDPLL
GQTAPVTLGHEFSGVVEEVGKDVTKYKKGDRVVVNPTVSRHEKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYALPDNVSAREGALVEPTAVAVQAVKEGNLLFGDKVAVFGAGPIG
LLTVVAAKAAGASKIYVFDLSEERLAKAKEVGATHVVNSGKVNPVEYINEHTDNGVDVTF
EVAGVGVTLQQSVEVTRPRGTVVIVSIFAHPVEFDPMLLTNSGVKLTSTIAYTPTTFQQT
VDLIANGSLDVKSVVTDEIELQDIVESGFEQLVNDKSQAKILVKLNGDQK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtcaaaaagatgttcgcgtggaagatcgtgaaccaaaa
gtattaaaagataatgaagttaaggttaaagtatcatggacggggatttgtggtacggac
ttacacgagtatttagaaggtcctgtctttatttctacagaacaacctgaccctttatta
ggtcaaactgcaccagtgacgttaggccatgaattttcaggcgtagttgaagaagtaggt
aaagacgtaactaaatacaaaaaaggggatcgtgttgttgtgaaccctaccgtgtctcga
catgaaaaagaagaaaatatcgatctttatgatggttattcatttattgggttgggatct
gatggtggatttgctgagtttacaaatgcaccagaagaaaatgtttacgcattacctgac
aatgtttcagctagagaaggtgctttagttgaaccaacagccgttgcagtacaagctgtc
aaagaaggcaacttattatttggtgataaagtagctgtctttggtgctggtccaattgga
ttattaacagttgtcgctgctaaagcagctggcgcaagtaaaatctatgtctttgattta
tctgaagaacgcttagctaaagctaaagaagtaggtgcaactcacgtcgttaattctggt
aaagttaatcctgttgaatacatcaacgaacacactgacaacggtgttgatgtcactttt
gaagttgctggcgtcggcgttacgttacaacaatctgttgaagtcactcgcccacgtggg
acagtagtcatcgtctctatctttgcgcacccggttgaatttgatccaatgttattaaca
aactctggagtgaaattaacttcaactattgcttatacaccaacgacattccaacaaacc
gttgacttaatcgctaacggtagcttggatgttaaatcagtcgtaacggatgaaatcgaa
ttacaagacattgttgaatcaggtttcgaacaacttgtaaatgataaatcacaagctaaa
atattagtaaaattaaatggcgaccaaaaataa

DBGET integrated database retrieval system