KEGG   Staphylococcus lugdunensis N920143: SLUG_05760Help
Entry
SLUG_05760        CDS       T01951                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00260  Glycine, serine and threonine metabolism
sln00680  Methane metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
sln01230  Biosynthesis of amino acids
Module
sln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sln_M00002  Glycolysis, core module involving three-carbon compounds
sln_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_05760
  Energy metabolism
   00680 Methane metabolism
    SLUG_05760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_05760
Enzymes [BR:sln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SLUG_05760
Membrane trafficking [BR:sln04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SLUG_05760
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SLUG_05760
  Exosomal proteins of melanoma cells
   SLUG_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCB53023
Position
635187..635873
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWTDVDLSEQGINEAVTAGRKVKENNIEIDVAYTSLLKR
ALETTNYILKESDQLWIPVHKSWRLNERHYGKLQGLNKDDARKEFGEEQVHKWRRSYDIE
PPAETEAQREEYLQSRKYRHLDKRMMPYSESLKTTLDRVVPIWTDHISQHLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIIGYEIKTGAPLVYELDDNLNVTNKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattaattttatgtagacatggacaaagtgaatggaacgcaaaaaacttattt
acaggatggactgatgtcgatttatctgaacaaggtattaacgaagcagtcacagctgga
cgtaaggttaaagagaacaacatcgaaattgatgtagcctatacatcactgttaaaaaga
gcgctagaaactacaaattatatccttaaagaatcagatcagttatggattccagtgcat
aaaagctggcgtttaaatgaaagacattatggtaagcttcaaggattaaataaagatgat
gcgcgaaaagaatttggtgaagaacaagttcataaatggcgtcgttcatatgatattgaa
ccaccagctgaaacagaagcacaacgtgaagaatatctacaaagcagaaaatatcgtcac
ttagataaacgtatgatgccatactctgaaagtttaaaaacaacattagatcgtgttgta
ccaatttggacagaccatatttcacaacatttattagatggtcaaacagtattagtttct
gcacatggtaactctattcgcgccttaatcaaatacttagaagatgtttcagatgaagac
attatcggttacgaaattaaaacaggtgcgccacttgtttatgaattagatgataactta
aacgttacaaataaatattatctttaa

DBGET integrated database retrieval system