KEGG   Staphylococcus lugdunensis N920143: SLUG_15030Help
Entry
SLUG_15030        CDS       T01951                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00020  Citrate cycle (TCA cycle)
sln00310  Lysine degradation
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Module
sln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLUG_15030 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SLUG_15030 (odhB)
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLUG_15030 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Macoilin
Motif
Other DBs
NCBI-ProteinID: CCB53989
Position
complement(1576341..1577651)
Genome map
AA seq 436 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEDAGVIQEQLA
NEGDTVEVGQAIAIVGEGSAEAKSAEASKSDGKAESKGESESETTTNTANEDTTRDHEQR
QDEAEKADRSDEVKKHTQRVNATPSARRHALKQGVDLAEVAGKSNDVVRKEDIDQRQQQS
SNKKAETAQRKAPETSSSSTPNKPVIREKMSRRKKTAANKLLEVSNNTAMLTTFNEVDMT
NVMELRKRKKEKFMQDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMIKKQYYDIG
IAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFG
SMMSTPIINGSQAAILGMHSIMTRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLK
TIKDLIENPEDLLLES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccggaattagcagaatcaattacagaggggaccattgcagaa
tggcttaaaaatgttggcgattctgttgaaaaaggagaagcaattttagaattagaaaca
gataaagttaatgtggaagttgtatcagaagatgcaggtgtgattcaagaacaacttgct
aatgaaggtgatactgttgaagtaggacaagccattgccattgttggagaaggtagtgct
gaagcgaaatcagcagaagcttcaaaatctgacggtaaggctgaatctaaaggtgagtcg
gagtcagaaacaactacaaatacagctaacgaagacacaactcgtgatcatgaacagcga
caagatgaagctgaaaaagcagatcgttctgacgaagtaaaaaaacatactcaacgtgta
aatgccacaccttcagcacgtcgtcatgctttaaaacaaggtgtagaccttgctgaagta
gcaggtaaatctaatgatgtcgtaagaaaagaagatattgatcaacgtcaacaacagtca
tcaaataaaaaagcagaaacggcacaaagaaaagcgccagaaacatcatcatcttcgaca
ccaaacaaaccagttattcgtgaaaaaatgtctcgtcgtaagaaaacagcagctaataaa
ttgcttgaagtatcaaataatacagcaatgttaacgacatttaatgaagttgatatgacg
aatgtgatggaattacgtaaacgtaaaaaagaaaaatttatgcaagatcatgatggtaca
aaattaggatttatgtcattcttcacaaaagcagcagtagccgcgttgaaaaaatatcca
gaagtcaatgctgaaattgatggagatgacatgatcaagaaacaatattatgatattggt
atagctgtatcaacagatgatggtttattagttccatttgtaagggactgtgataagaag
aattttgcagaaatcgaacaagaaattgctaatttagcagttaaagcgcgtgataaaaaa
ttaggcttagacgacatggtaaatggatcatttacaattactaacggtggtatcttcggt
tcaatgatgagtacgccaatcatcaatggtagtcaagcagcaatattaggtatgcattca
attatgacacgtccaattgcaattgataaagatacaattgaaaatcgaccaatgatgtat
attgctttaagctatgatcacagaattattgatggtaaagaagcagtaggtttcttgaaa
acaattaaagatctcattgaaaatccagaagatttattattagaatcataa

DBGET integrated database retrieval system