KEGG   Staphylococcus lugdunensis N920143: SLUG_21340Help
Entry
SLUG_21340        CDS       T01951                                 

Definition
(GenBank) putative phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sln  Staphylococcus lugdunensis N920143
Brite
KEGG Orthology (KO) [BR:sln00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SLUG_21340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCB54658
Position
complement(2259110..2260111)
Genome map
AA seq 333 aa AA seqDB search
MDYVLIITIAIVVFSLIFDFINGFHDTANAVATAVSTRALTPRRAILLAAIMNFIGALTF
TGVAGTITKDIVNPFELHNGLVVVLAAIISAIIWNLVTWFYGIPSSSSHALIGSIAGAAI
ASTGSFMDIHYQGFTKIIIVLIISPIIAFCVGYIMYSIVKIVFKNANLTRSNRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVADVQHQVEPQLWVKVACATAMGLGTAIGGWKI
IKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGAANRVKGVK
WSTAQRMVITWVITLPISAVLAAIIYLIMHIFL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggattacgtattaattattacgatagctatcgttgttttttcattgatatttgacttt
atcaacggttttcacgatactgcaaacgcggtagctacagcggtatctactcgtgcttta
acgccgagaagagctatactattagctgcaattatgaattttattggtgccttaacattt
actggtgtggcaggaacaattacaaaggatattgtaaatccatttgaattacataatggg
ctcgttgtcgtacttgcagcaattatttcagcaattatttggaatttagtaacatggttt
tatggtatacctagttcatcatctcatgctttgattggttcaattgcaggtgcagcaatt
gcatcaactggttctttcatggatattcattatcaaggatttaccaaaattattatcgta
ttgattatttcaccaatcattgcattttgtgtaggttatatcatgtattccattgtgaaa
attgtctttaaaaatgcgaatttaacaagatctaaccgtaactttagatttttccaaatt
tttacggcagcattgcaatccttctcacacgggacaaacgatgctcaaaaatcaatgggg
attattaccttagctttaatcgtagctgatgtgcaacaccaagtagaacctcagttatgg
gttaaagtagcttgtgctaccgcaatgggcttaggtactgcaattggtggttggaaaatc
atcaaaactgtaggtggtaatatcatgaaaattagacctgctaacggtgcagcagctgat
ttatcatcagcattaactattttcgtggcttcatcactacatttcccattatctactacg
cacgttgtatcttcatctattctaggtgtaggtgcagctaatcgtgtgaaaggcgtaaaa
tggagtacagcgcaacgtatggttatcacatgggtaattacattacctatttcagctgta
ttggcagctattatctatttgattatgcatattttcttataa

DBGET integrated database retrieval system