KEGG   Shewanella loihica: Shew_2390
Entry
Shew_2390         CDS       T00489                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
slo  Shewanella loihica
Pathway
slo00620  Pyruvate metabolism
slo00640  Propanoate metabolism
slo00650  Butanoate metabolism
slo01100  Metabolic pathways
slo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_2390
   00640 Propanoate metabolism
    Shew_2390
   00650 Butanoate metabolism
    Shew_2390
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Shew_2390
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABO24256
UniProt: A3QFK8
Position
2802496..2804778
AA seq 760 aa
MTEKTELFTKAWEGFTPGDWKSEVNVRDFIQKNYKPYEGDESFLAGATEATSALWDKVME
GIKQENRTHAPVDFDTDKVSTITSHAAGYIDQDLETIVGLQTDAPLKRAMLPNGGIRMVE
GSCAAYGRELDPNIKYVYSELRKTHNQGVFDIYTPEIMRCRKSGVLTGLPDAYGRGRIIG
DYRRIALYGIDYLMQEKFAQFSSLQAQFEAGEDLSATMQLREEIAEQHKALGQMKQMAAS
YGCDISGPATNAKEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDIYIERDINNGVLTEQ
QAQEMVDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIAGMGLDGRTLVTKSSFRFLHT
LYNMGPSPEPNITVLWSEKLPLNFKKYCAKVSIDTSSIQYENDDLMRPDFDSDDYAIACC
VSPMVVGKHMQFFGARANLAKTMLYAINGGVDEKLKTQIGPKFEPIKDEVLDFDDVMGRL
DTMMEWLATQYVSALNAIHYMHDKYSYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KFAKVKPIRDENGIAVDFDIEGEYPKFGNNDARVDDLATELVERFMAKIRHKKMYRNAIP
TQSILTITSNVVYGKKTGTTPDGRPAGAPFAPGANPMHGRDEKGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDDDGRRANLAALMDGYFAHNETREGGQHLNVNVMNREMLEDAV
VNPDKYPQLTIRVSGYAVRFNALTPEQQQDVITRTFTKGM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaactgagctgttcaccaaagcgtgggaaggttttactcctggtgattgg
aagtctgaagtaaatgtacgcgactttattcaaaagaactacaagccctatgaaggagac
gaatctttcctagcaggcgccaccgaagcgaccagtgcgctttgggacaaagtgatggaa
ggtatcaaacaggaaaaccgcacccacgcgccggttgatttcgataccgacaaagtctct
accattacctctcatgctgcaggttacatcgaccaagatcttgaaaccattgtcggtcta
caaacagacgcgccacttaagcgtgccatgttacccaatggcggtatccgcatggtcgaa
ggttcatgcgctgcctatggtcgtgaactggatccaaacatcaaatatgtctactcagag
ctgcgcaagacccacaaccaaggcgtgttcgacatctacacccctgagatcatgcgctgc
cgtaagtctggcgtactgacaggtctgccagatgcttacggccgtggtcgtatcattggt
gactaccgtcgtatcgccctgtacggtatcgattatctgatgcaggaaaaatttgcccag
ttcagctcactgcaggcgcagtttgaagcgggtgaagatctttcagccaccatgcaacta
cgcgaagagatcgccgagcagcacaaagccctgggtcagatgaagcagatggctgccagc
tacggctgtgacatctcaggtcctgcaaccaacgctaaagaagcgattcagtggacttac
ttcggctacctggccgcagtgaagagccaaaacggcgccgccatgtctcttggccgtacc
tctagcttcctggatatctacatcgagcgtgacatcaacaatggcgtgttgaccgaacaa
caagcccaggagatggttgaccatttcgtgatgaagctacgtatggtgcgcttcctacgt
acccctgagtacgacgagctattctctggcgacccaatctgggctaccgagtctatcgcg
ggtatgggtcttgatggccgtactctggtgactaagtctagtttccgcttcctgcacacc
ctatacaacatgggtccaagccctgagccaaacatcacagtgctttggtcagagaagcta
ccacttaacttcaagaagtactgcgctaaggtctctatcgataccagctctattcagtac
gaaaacgatgacctgatgcgtccagatttcgattctgacgactacgccatcgcctgttgt
gtgagccctatggttgttggtaagcacatgcagttcttcggtgcccgcgccaacctggcc
aagaccatgctttacgccatcaacggcggtgtggatgagaagcttaagacacagatcggc
cctaaatttgagccaatcaaagatgaagtgctggactttgacgatgtgatgggccgcctg
gacaccatgatggagtggttagccacccaatatgtgtctgcactgaacgctatccactac
atgcacgacaagtactcttacgaagcggccctgatggcgctacatgacagagacgtacgt
cgcaccatggcttgtggtatcgctggtctgtctattgctgccgactcactgtctgccatc
aagtttgccaaggttaagccaattcgtgacgaaaacggcatcgccgtcgatttcgacatc
gaaggtgaatatcctaagtttggtaacaacgatgcacgcgtcgatgacctggctaccgag
ctggttgagcgcttcatggctaagatccgtcacaagaagatgtaccgtaacgcgatcccg
actcagtctatcctcaccatcacctcaaacgtggtttatggtaagaagacagggacgaca
ccagacggtcgtccagccggcgcgccatttgcaccgggcgcaaacccaatgcacggccgt
gacgagaaaggcgctatcgcctcactgacttcagttgccaagctgccatttgctcacgca
caggacggtatctcttataccttctctatcgtgccaaatgccctgggtaaagatgacgac
ggtcgccgcgctaacctggctgcgctgatggatggttacttcgctcacaatgagacccgc
gaaggtggtcagcacctgaacgtgaacgtgatgaaccgcgaaatgctggaggatgcagtg
gttaaccctgacaaatatccacagctgactatccgtgtttctggttacgccgtgcgcttc
aacgcactgacaccagagcagcaacaggacgtcattacacgtactttcaccaaagggatg
taa

DBGET integrated database retrieval system