KEGG   Shewanella loihica: Shew_0878Help
Entry
Shew_0878         CDS       T00489                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
slo  Shewanella loihica
Brite
KEGG Orthology (KO) [BR:slo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Shew_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABO22750
UniProt: A3QBA2
Position
complement(997868..998248)
Genome map
AA seq 126 aa AA seqDB search
MKQLESSIRIEVKTDYIEEQSSPEEERYLFSYTITIINLGDEAVTLKSRMWCITDANGHE
SKVEGAGVVGETPTIKPNTAYQYTSGTVCETPFAVMQGYYVMVTEQGETFKAPIAPFRLA
APGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaactcgaatcctcaatcaggattgaggtcaaaaccgactatatcgaagagcaa
tcttcgcccgaagaagagagatacctgttcagctacaccatcaccatcatcaacttaggg
gatgaagccgtcaccctgaagagccgcatgtggtgcatcacagacgccaatggccatgag
agtaaggttgaaggcgcaggtgtggttggcgagacccctaccatcaagccaaataccgcc
taccagtacaccagtggcacggtatgcgagacgccctttgccgtcatgcagggctactat
gtgatggtgaccgaacagggtgaaaccttcaaggcacccatcgcccccttccgtctagcg
gcccccggcctgctgcattaa

DBGET integrated database retrieval system