KEGG   Shewanella loihica: Shew_1005Help
Entry
Shew_1005         CDS       T00489                                 

Definition
(GenBank) rRNA (guanine-N(1)-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
slo  Shewanella loihica
Brite
KEGG Orthology (KO) [BR:slo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:slo03009]
    Shew_1005
Enzymes [BR:slo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Shew_1005
Ribosome biogenesis [BR:slo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Shew_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran PriA_CRR
Motif
Other DBs
NCBI-ProteinID: ABO22876
UniProt: A3QBM8
Position
1162084..1162908
Genome map
AA seq 274 aa AA seqDB search
MNSHYLCPLCQAPLMVHQGSQGLHCANKHHFDKGPQGYWVFSQPKKPHIDSRQLMRAKHF
LLESGIFAPVVEAIQRQLTERLPSDATLSHLDVDSGEGYYLRALAGVFNALGQAVEQTGV
AEAENALFVAAKAQPEANLVQSQLKVLPFADDSFDLVSLFDKPLKGKEPLRVLKPGGTFI
WLSPGPRHLWQIREFIYPNLTEKGGEPQQPKGVTLVASEHITYSLALSGEQALTLLEMTP
FAWRANDKIKRQITQQEFAALEIDLYLTLATKDA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtcattatttgtgtcccctctgccaagcgccgctgatggtgcatcaaggcagc
caggggctacactgcgccaacaagcaccatttcgacaaggggccgcaggggtactgggtg
ttcagtcagcccaagaagccccatatcgattcgcggcagttgatgcgtgccaaacacttt
ctgttggaatcgggtatcttcgcccccgtggtcgaggccattcagcgtcagctaactgag
cgattgccgagtgatgccacgttgtcgcatctggatgtcgacagcggcgagggttattac
ctgcgggcgctggctggtgtgtttaacgcgcttggccaagccgttgaacagacaggtgtc
gccgaggcggagaacgccctgtttgtggcggcaaaggcgcagcctgaggccaatctggtt
cagagccagctcaaggtgttacccttcgccgatgacagcttcgatctggtgagcctgttc
gataagccgctcaaaggcaaggagccgctgcgggtgcttaaacccggcggcacctttatc
tggttatcgccgggcccgcgtcacctgtggcagattagagaatttatctatcctaactta
accgagaaaggcggtgagccgcagcagcctaaaggtgtcaccctggtggcgagcgagcac
attacttattccctggcgctcagcggcgagcaggcgctgacgttgctggagatgaccccc
tttgcctggcgggccaacgataagataaagcggcagatcactcagcaggagtttgcggcg
ctggagatagatctctatctcaccctggcgacgaaagatgcttag

DBGET integrated database retrieval system