KEGG   Shewanella loihica: Shew_1418Help
Entry
Shew_1418         CDS       T00489                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
slo  Shewanella loihica
Pathway
slo00040  Pentose and glucuronate interconversions
slo00052  Galactose metabolism
slo00500  Starch and sucrose metabolism
slo00520  Amino sugar and nucleotide sugar metabolism
slo01100  Metabolic pathways
slo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Shew_1418
   00052 Galactose metabolism
    Shew_1418
   00500 Starch and sucrose metabolism
    Shew_1418
   00520 Amino sugar and nucleotide sugar metabolism
    Shew_1418
Enzymes [BR:slo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Shew_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Pox_RNA_Pol_22 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABO23286
UniProt: A3QCT8
Position
1631972..1632892
Genome map
AA seq 306 aa AA seqDB search
MGGCLFYHIGFFMKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVSAGVKE
IVLVTHASKNAIENHFDTSYELESTLEKRVKRQLLDEVQSICPKDVTIMHVRQGEAKGLG
HAVLCAKPCIGNNPFAVVLPDVILDEYSADQSSENLAAMIKHYKATQASQIMVAPVALDE
VNKYGIADCGGVNIEPGESSVIKAMVEKPAIDEAPSNLAVVGRYVLSEKIWDLLAKTPAG
AGDEIQLTDAIDMLIESDTVEAFNMTGKSHDCGDKLGYMAAFVEYGLRNEKLGKEFRQQL
DNLLAQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggggggttgtctgttttatcatattggattttttatgaaagttgttattcctgttgca
ggtcttggcacgcgcatgttgcctgcaaccaaagccataccgaaagagatgttgccgcta
gttgacaagccactcattcaatatattgttaacgagtgcgtatcagctggtgtgaaagag
attgtattggtaactcatgcgagtaagaatgctatcgagaaccattttgatacttcctat
gaacttgagtctacgcttgagaagcgtgtaaagcgtcagttactggacgaggtgcaatca
atttgccccaaagatgtgaccatcatgcacgtgcgccaaggcgaggctaaggggcttggt
catgccgtactttgtgctaaaccttgtattggcaataaccctttcgctgtcgtattgccg
gatgtgatcttagatgagtacagtgccgatcaaagctcagaaaaccttgcggcaatgatt
aaacattataaagcgactcaagctagccaaatcatggtagcgccagtggctctagatgaa
gttaacaagtacggaattgccgattgcggcggagtgaatatcgaacctggtgaatcatca
gttattaaggctatggttgaaaagcctgctattgatgaagccccgtctaatcttgctgtt
gtaggtcgttacgttttgtctgaaaaaatctgggacttgctggctaaaacccctgctggt
gcaggggatgaaatccaattgacagacgcaatcgacatgttgattgaatctgacactgtc
gaagccttcaatatgacaggtaagtctcacgattgtggcgacaagcttggttatatggca
gcctttgttgaatacggcctgcgtaatgaaaagctgggtaaagagtttcgtcagcagtta
gataacctgctagcacaataa

DBGET integrated database retrieval system