KEGG   Shewanella loihica: Shew_1533Help
Entry
Shew_1533         CDS       T00489                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slo  Shewanella loihica
Pathway
slo00010  Glycolysis / Gluconeogenesis
slo00620  Pyruvate metabolism
slo00640  Propanoate metabolism
slo00680  Methane metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew_1533
   00620 Pyruvate metabolism
    Shew_1533
   00640 Propanoate metabolism
    Shew_1533
  Energy metabolism
   00680 Methane metabolism
    Shew_1533
Enzymes [BR:slo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Shew_1533
Lipid biosynthesis proteins [BR:slo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shew_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABO23400
UniProt: A3QD52
Position
complement(1758093..1760045)
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYKVPSEIAANAHINDEKYKKMYQESVVNPEGFWREHGQRIDWMKPFTKVKKTSF
DDHNLSINWFYDGTLNASVNCLDRHLADNADKLAIIWEGDDAADQRTLTYGELHTEVCKF
ANALRSQGVRRGDVVTVYMPMVPEAAVVMLACARIGAIHSVVFGGFSPDSIASRVIDGKS
KVVITADEGVRGGRTIPLKANIDEALSHPDVTCVEKVIVLERTGNPVNWVEGRDIKWASL
METASEHCVAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYASMTHEYVFDYKEGEI
YWCTADVGWITGHSYMVYGPLANGATILIHEGIPNYPTPARLGEMIDRHKVNILYTAPTL
IRALMAEGKEQFDGFDGSSLRIMGSVGEPINPEAWRWYHEVIGHENCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIIDGAAEGNLVILDSWPGQMRTVYGD
HDRFALTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHE
HVAEAAVVGYPHDIKGQGIYAYVTLTKGTQESEELRQELRQWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIDTLIETRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagtctctctacaaagttccaagcgaaatcgcggcgaatgcccatattaat
gacgagaaatataagaagatgtatcaggaatctgtggttaatcccgaaggtttctggaga
gagcatggccagcgcatcgattggatgaagccttttactaaggtcaagaaaacctccttc
gacgatcataacctgtcgatcaactggttctatgacggcacccttaacgcctcggttaac
tgtctcgacagacacctggccgacaacgccgataagctagccatcatctgggaaggtgat
gacgcggccgatcaacgcaccctcacctatggtgaactccatacagaggtgtgtaagttt
gccaacgccctgcgcagccaaggcgtgcgtcgtggtgacgtggtcacggtttacatgcca
atggtgcccgaagccgccgtggtcatgctggcatgtgcccgcattggcgccatccactct
gtggtgttcggtggcttctcgcctgactctatcgcctcacgagtgatcgacggcaagtcc
aaggtcgtgatcaccgccgacgaaggcgtgcgcggtggccgcactatcccactaaaagcc
aacatagatgaggccttgtctcacccagacgtgacctgtgtcgagaaggtgatcgtgctt
gagcgtaccggcaaccccgtcaattgggttgagggacgcgacatcaagtgggcgtcacta
atggaaaccgcctcagagcactgcgtggccgaagagatgggcgccgaagatcccctcttc
ctgctctatacatctggctctaccggtaaccctaagggcgtgctgcacaccacggggggg
tacctggtctatgcctcgatgacccacgaatatgtgtttgactacaaagagggtgagatc
tactggtgtaccgccgacgtgggttggatcaccggtcactcctacatggtctatggcccg
ctggctaacggcgcgaccatattgatccacgaaggtatccctaactacccaacgccagcc
cgtctgggtgagatgatcgaccgccataaggtcaacatcctctacacggcgccgacgttg
atccgtgctctaatggcagaaggcaaggagcagttcgatggcttcgatggcagctcgctg
cgcatcatgggctctgtgggtgaacctattaacccagaggcctggcgctggtatcacgag
gtgatcggccatgagaactgccctatcgtcgatacctggtggcaaaccgaaaccggtggc
atcttgatctcgccactgccgggcgccactgatactaagccaggttctgccacacgcccc
ttcttcggcgtgcagccagccctggtggacaacatgggcaacatcatagatggcgcagcc
gagggtaacctggtgatcctcgactcctggccaggacagatgcgcaccgtatacggtgac
cacgacagattcgcgctgacctacttcaagaccttccgtggcatgtactttactggtgac
ggtgctcgccgcgatgaagatggctactactggatcactggccgagtcgatgacgtgatt
aacgtatcgggccaccgcctgggtaccgccgaggtcgagagcgccctggtggctcacgag
catgtcgccgaggccgccgtggtgggctaccctcacgacatcaagggccaaggaatctat
gcctatgtcaccctgaccaagggcactcaggagagcgaagagctgcgccaggagctgcgt
caatgggtcagaaaagagattggtgccctggcgacgccggatctgatccagtgggccggc
ggtctgcctaagacacgttcgggtaagatcatgcgccgcttcctgcgtaagatcgccgcc
aacgaagtgaccaacttaggtgatgcgtcaactctcgctgatccagcggtgatcgacacc
ctgattgagacgcgtctcaaccgcagcgaataa

DBGET integrated database retrieval system