KEGG   Shewanella loihica: Shew_1667Help
Entry
Shew_1667         CDS       T00489                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slo  Shewanella loihica
Pathway
slo00071  Fatty acid degradation
slo00072  Synthesis and degradation of ketone bodies
slo00280  Valine, leucine and isoleucine degradation
slo00310  Lysine degradation
slo00362  Benzoate degradation
slo00380  Tryptophan metabolism
slo00620  Pyruvate metabolism
slo00630  Glyoxylate and dicarboxylate metabolism
slo00640  Propanoate metabolism
slo00650  Butanoate metabolism
slo00900  Terpenoid backbone biosynthesis
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
slo01212  Fatty acid metabolism
slo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_1667
   00630 Glyoxylate and dicarboxylate metabolism
    Shew_1667
   00640 Propanoate metabolism
    Shew_1667
   00650 Butanoate metabolism
    Shew_1667
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shew_1667
   00072 Synthesis and degradation of ketone bodies
    Shew_1667
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shew_1667
   00310 Lysine degradation
    Shew_1667
   00380 Tryptophan metabolism
    Shew_1667
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shew_1667
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shew_1667
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shew_1667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slo04147]
    Shew_1667
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shew_1667
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABO23534
UniProt: A3QDI6
Position
1915940..1917130
Genome map
AA seq 396 aa AA seqDB search
MSTEQTNQEIVIVAAKRTPMGGFQGSLSSVPSPTLAATAIKGLMDAAGVQGGDVNEVLMG
CVLPAGLGQAPARQATLGADLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSADVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADDFGITREA
MDNFALSSLQKANAAIESGAFKAEIVPVTVASRKGDLVVDTDEQPGNARPEKIPTLRPAF
AKDGTITAANSSSISDGAAVLMMMSADEASKRGLEVLATIKGHTTHSQEPSMFTTAPVGA
MNKLLDKVNWSKDEVDLFEINEAFAMVTMLAISELGLDEAKVNVNGGACALGHPIGCSGA
RVLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagagcaaactaaccaagaaatcgtgattgtcgcggctaaacgcaccccaatg
ggcggattccagggatccctttccagcgtgccgtcaccgacactcgccgccacggcgatc
aagggactcatggacgctgccggcgttcagggcggcgatgtcaacgaagtcttgatgggc
tgcgtattaccggcgggcctgggtcaggcgccggcgcgtcaggcaaccttaggtgcggat
cttcccctgtctgtgggcgcgactacagtcaacaaggtgtgtggttcgggcatgaagaca
gtcatgctggctcacgacctgatcaaggctggtagcgccgatgtcgtgatcgccggtggc
atggagagcatgagccaggcgccttacctgctggataaggctcgtggcggcatgcgcatg
ggtcatggcaaggtgctggatcacatgttcctcgatggtctggaagatgcttacacaggc
ggcgccatgggcacctttgcccagaagacggccgatgattttggtattacccgtgaggcg
atggataacttcgccctgagctcgctgcaaaaagctaacgctgcgatcgaatctggtgcc
ttcaaggcagagatagtgccggttaccgtggcgagccgtaaaggcgatcttgttgtcgat
accgacgagcagccaggtaacgcaagacccgagaagatcccaactctgcgtcccgctttt
gccaaagatggcaccatcacagctgccaactcaagctctatctcagatggcgctgccgtg
ttgatgatgatgagtgccgatgaggcgagcaagcgcggtctagaagttctggccactatc
aagggccatactactcattcacaagagccttctatgttcaccacggcgccagtgggtgcc
atgaacaagctgctggataaggtgaactggtcgaaagacgaggtggatctgtttgagatc
aacgaagccttcgccatggtcaccatgcttgccatctctgaacttggcctggatgaggct
aaggttaacgtcaatggcggcgcctgtgcacttggccatcctatcggctgctcgggtgcc
cgcgtgctggtcaccctgatccacgctctgaaggccagaggccttaagcgtggcgtggca
tcactttgtatcggtggtggtgaagccacggccatggctatcgaagtgtaa

DBGET integrated database retrieval system