KEGG   Shewanella loihica: Shew_2165Help
Entry
Shew_2165         CDS       T00489                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
slo  Shewanella loihica
Pathway
slo00010  Glycolysis / Gluconeogenesis
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew_2165
Enzymes [BR:slo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Shew_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABO24031
UniProt: A3QEY3
Position
2516172..2517026
Genome map
AA seq 284 aa AA seqDB search
MGSVTVKKHPQGLEYVEVDTDLCQARIFMQGAQIDRFQPKGQAPLLWVSSADDYQPGSGI
RGGIPVCWPWFGMHENPQWPQHGFARTRLWNLDSVQMQDQVVELKFSLTVSDEDKQYWAH
PSRVELIFTLSDSLSVSLVNTNLGNAPFNLTQALHTYFPIEDIHQLKASGFSGARYIEFG
EGPFEQEGDEVHFDRETDRVYTQLGDCQLLHTPQGIIEVRRENSRSAVLWNPWIEKSKRL
SRFNDQDYLTMVCLEAANVLEDRVELAPGESHTLSTHIRWQPQG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtaaccgtaaaaaaacatccccagggactcgaatatgtcgaggtcgatacc
gatctctgtcaggcgcgcatcttcatgcaaggcgcccagatagacaggtttcagcctaag
ggccaagccccgctgctctgggtgtctagcgccgacgactatcagccgggtagtggcatc
cgtggcggcatccctgtctgctggccctggtttggcatgcatgagaaccctcagtggccg
caacacggttttgcccgtacccgtctatggaatttagattcggtgcagatgcaggatcag
gtggtggagctcaagtttagcctgacggtaagcgatgaagacaagcagtactgggcgcat
ccgagcagggtcgagctcatctttaccttaagcgatagcctaagcgtcagcctggtcaac
accaaccttggtaatgcgccgttcaatctgacccaggcgctgcacacctacttccctatc
gaagatattcatcagcttaaggccagcggctttagcggcgcccgctatatcgagtttggc
gaaggccccttcgagcaggagggcgatgaggtgcactttgaccgggaaacagaccgtgtc
tacacccagcttggcgactgccagttactgcatacgccacaggggatcatagaggtgcgc
cgcgaaaacagccgatcggcggtgctgtggaatccttggatagagaaatctaagcgtctg
tcgcgctttaacgatcaggattatctcaccatggtctgcctcgaggccgctaatgtatta
gaagatagggtcgagctggcgccgggtgagtctcataccctgagcacccatatccgctgg
caacctcagggctaa

DBGET integrated database retrieval system