KEGG   Shewanella loihica: Shew_2858Help
Entry
Shew_2858         CDS       T00489                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slo  Shewanella loihica
Pathway
slo00071  Fatty acid degradation
slo00072  Synthesis and degradation of ketone bodies
slo00280  Valine, leucine and isoleucine degradation
slo00310  Lysine degradation
slo00362  Benzoate degradation
slo00380  Tryptophan metabolism
slo00620  Pyruvate metabolism
slo00630  Glyoxylate and dicarboxylate metabolism
slo00640  Propanoate metabolism
slo00650  Butanoate metabolism
slo00900  Terpenoid backbone biosynthesis
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
slo01212  Fatty acid metabolism
slo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_2858
   00630 Glyoxylate and dicarboxylate metabolism
    Shew_2858
   00640 Propanoate metabolism
    Shew_2858
   00650 Butanoate metabolism
    Shew_2858
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shew_2858
   00072 Synthesis and degradation of ketone bodies
    Shew_2858
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shew_2858
   00310 Lysine degradation
    Shew_2858
   00380 Tryptophan metabolism
    Shew_2858
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shew_2858
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shew_2858
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shew_2858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slo04147]
    Shew_2858
Enzymes [BR:slo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shew_2858
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UPF0731
Motif
Other DBs
NCBI-ProteinID: ABO24724
UniProt: A3QGX6
Position
3389550..3390734
Genome map
AA seq 394 aa AA seqDB search
MREAVIVSTARTGMAKSFRGSLNNTKSPTMLGHCIKQAVQRAGVEGGEIDDAIMGTVLTA
GTAGMNIARNAVLAAGLPNTVSAQTIDRQCSSGLMAIGMAAKQIIVDQQQIVVAGGQENI
TAVQNEYMKWAADNADPNVMQFEPHAYMPMLKTAEHVAKVYGVSREAQDIYALMSQQRTA
AAQEAGYFDDEIVPFTTTMAIQDRETKAISYQQVTLDRDECNRPSTTMESLQNLAPVIEG
GFITAGNASQLSDGASACVVMERKLAEQRGLAPLGIYRGIAVAGCAPEEMGIGPIYAIPK
LLKQHGLTIDDIGLWEINEAFAVQALYCRDHLGIDPARYNVNGGGISIGHPYGMTGSRLV
GHALIEGKRRGVKYVVVGMCIGGGMGAAGLFEVA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgtaatcgtatccaccgcccgcaccgggatggcaaagtcatttcgcgga
tcgttaaacaacaccaagtccccaaccatgctgggtcactgcatcaagcaagccgtccag
cgcgccggggtcgagggcggcgagatagatgatgccatcatgggcacagtgctcaccgcc
ggcaccgccgggatgaacatcgcccgtaacgccgtgctggccgccggcctgcccaatacc
gtctcggcccagaccatagaccgtcaatgctcatcgggcttgatggccatcggcatggcc
gcgaaacagatcatcgtcgatcaacagcagatagtggttgccggcggccaggaaaacatc
accgccgtacagaatgaatatatgaagtgggccgccgataacgccgaccccaacgtgatg
caattcgagccccacgcctacatgccaatgctgaagaccgccgagcatgtggccaaggtc
tatggcgtcagccgcgaggctcaggacatctacgccttgatgtcgcagcagcgcaccgcg
gccgcccaggaggccggctacttcgacgacgaaatcgtgcccttcaccaccaccatggcg
attcaggaccgcgagaccaaggcgatctcctaccagcaggtaactcttgaccgcgacgag
tgtaaccgcccatcgaccaccatggagagcctgcaaaatctggcgcctgtgatcgaaggt
ggcttcattaccgcgggtaacgccagccagctcagcgacggcgcctccgcctgtgtggtg
atggaacgtaaactggccgagcagcgtggcctggcgccacttggcatctaccgcggcatt
gcggtagccggctgcgcgccggaagagatgggcataggccccatctacgccatccctaag
ctgctgaaacagcacggtctgaccatagacgatatcggactgtgggagatcaacgaggcc
ttcgcggtgcaggcgctctactgccgcgaccacctggggatcgatcccgcccgctacaac
gtcaacggcggcggcatctctatcggccacccctacggcatgacaggctcgcgtctggtg
ggccatgcgctcatcgaaggcaagcgccgcggcgtcaaatatgtggtcgtcggtatgtgt
atcggcggcggcatgggcgcggccggcctgttcgaagtcgcctaa

DBGET integrated database retrieval system