KEGG   Shewanella loihica: Shew_3014Help
Entry
Shew_3014         CDS       T00489                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
slo  Shewanella loihica
Pathway
slo00330  Arginine and proline metabolism
slo00332  Carbapenem biosynthesis
slo01100  Metabolic pathways
slo01130  Biosynthesis of antibiotics
slo01230  Biosynthesis of amino acids
Module
slo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Shew_3014
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Shew_3014
Enzymes [BR:slo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Shew_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABO24880
UniProt: A3QHD2
Position
3579485..3580585
Genome map
AA seq 366 aa AA seqDB search
MANIHWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFIANCRAQGVQVVLVSSGSVAAGWH
RLGDVKQPSVSQKKAMAAAGQADMMATWDKLFDFPSAQLLVTHGDLRDRERYISIKNTLF
SLLDHGLLPIVNENDAVTTDTLRVGDNDNLSAMVAAAADADALIICSDVNGLYTKNPQLH
DDAKLIKQVNEINEAIYAMAGGATSEVGTGGMRTKIEAAEKAIAHGIETVIINGFDPDAF
NRLLKGQNPGTLFTPFDQPMQEHVHWMTHTSQAQGEVIVEDNFDAPLDDQETQLTSDDVV
AVKGNFSVGDTILVRKGDGTKLAKAQANYSSCLLSFIAKQPDRAFAHDVEQQTGPILSDE
NIAILE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatacactggaaacgcatcgtcgttaaggtgggtagtgccctgatcgcgccc
cataagcaaggatgcagcagccactatctgctgggtatcgcccaatttatcgcgaactgc
cgcgcccaaggcgtccaggtcgtcctggtctcctcgggttctgtggccgccggctggcac
cgactgggtgacgtcaaacagccaagcgtatcgcagaagaaggcgatggccgccgcgggc
caggccgatatgatggccacctgggataagttattcgactttccctcggcccagctactg
gttacccatggggatctcagggatcgcgagcgttacatcagcatcaagaacaccctgttt
agcctgctggaccacggcctgctgcccatagtcaacgagaacgatgcggtcaccacagac
acactgcgtgtcggtgacaacgacaacctgtcggccatggtcgcggcggcggccgatgcc
gacgccctgatcatctgctccgacgttaacgggctctacaccaagaatccccagctgcac
gatgatgccaagctgatcaaacaggtgaacgagatcaatgaagccatctacgccatggct
ggcggagccaccagcgaggtcggcaccggcggcatgcgcaccaagatagaggcggccgag
aaggcgatcgcccacggcatagagacggtgatcatcaatggcttcgaccccgatgccttc
aaccgtctgctcaaggggcagaacccaggcaccctgtttaccccattcgaccagcccatg
caggagcatgtgcactggatgacccatacctcacaggcccagggcgaagtgattgtcgaa
gataacttcgacgcccccctggacgaccaggagacgcaactgaccagcgacgatgtggtg
gccgtaaaaggcaacttttccgtcggtgacaccatcttagtgcgcaaaggcgatggcact
aagctggcgaaggcccaggccaattacagcagttgcttactgagttttatcgccaagcaa
ccggaccgagcctttgcccacgatgtcgagcagcaaaccggtcccatcttaagcgatgag
aacatcgccatattggagtaa

DBGET integrated database retrieval system