KEGG   Syntrophothermus lipocalidus: Slip_0054Help
Entry
Slip_0054         CDS       T01253                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00450  Selenocompound metabolism
slp00970  Aminoacyl-tRNA biosynthesis
slp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Slip_0054
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Slip_0054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slp01007]
    Slip_0054
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slp03016]
    Slip_0054
Enzymes [BR:slp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Slip_0054
Amino acid related enzymes [BR:slp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Slip_0054
Transfer RNA biogenesis [BR:slp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Slip_0054
 Prokaryotic type
   Other AARSs
    Slip_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADI00861
UniProt: D7CIJ6
Position
60550..62490
Genome map
AA seq 646 aa AA seqDB search
MGDGKSFYITTPIYYPSDNLHIGHAYTTVAADCIARYKRMQGYDVFFLTGSDEHGQKIER
TARDKGMEPKAYVDRIVDGFKVLWDTLLISHNDFIRTTEERHEKAVQTIFQKVYEKGDIY
KAKYEGWYCTPCEAFWTERQLVDGKCPDCDRPVELTQEESYFFAMSKYAERLLKHIEENP
DFIQPESRRNEMINFIKSGLEDLCVSRTTFEWGIPIPFAPGHVIYVWFDALVNYLTAVGY
PDDQEKFGKYWPADVHLVGKDIVRFHTVIWPTILMAADLPLPKQVFGHGWLMLEGGKMSK
SKGNVVDPLILVEKYGVDSIRYYLLKELNYGMDGYYSEEMLIARINSDLANDLGNLVSRT
IGMIERYCQGVIPVPGPQEGLDQELVDTAAAVYGEVGRQLDRLDFSSALGAVWRLISRAN
KYIDESAPWLLARDEAKRERLNTVLYNLAEVIRITGIMLAPFMPTLPGRINRQIPVFDDP
EQLRWGEAGKWGLLVSGRKVAKGESLFPRIDLKTLEKDDKETSAEPIAAEPGPEVNDLQE
FITIDEFARVHLRVAEVIAAEKMKKADKLLVLKVRLGEEERTIVAGIAQHYTPEELVGKK
IVVVANLKPTKLRGVESQGMLLAASNEEGLAILTLDRDLPSGCKIK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatggcaagagtttttacataacgactcccatttactatcccagcgacaacctg
catataggtcatgcttataccacggtagctgcggattgcatagcgcgctacaagcggatg
caggggtatgacgtgttctttctcaccggttcggacgaacacggccaaaagattgaacgc
acggcccgggacaagggaatggaacctaaggcatacgtagacagaatcgtagacggattc
aaggtgttgtgggataccctgttaatcagccacaatgacttcatccgtaccaccgaagag
cggcacgaaaaagccgttcagactattttccagaaagtttatgaaaaaggcgatatttac
aaggcaaaatacgaggggtggtactgcactccttgtgaagccttttggacggaacgccag
ctagttgacggtaaatgtccggactgcgaccgcccggtggagctgacccaggaggaaagc
tatttctttgctatgtccaagtatgccgagcggttgctcaaacacatcgaagaaaacccg
gacttcatacaacccgaatccaggcgaaacgagatgataaacttcatcaaatcggggctt
gaagatctctgtgtttcccggactactttcgaatggggaataccgatcccgtttgcccct
gggcacgtcatttatgtttggtttgatgctctggtaaattatttgactgccgtgggatac
cccgacgaccaggaaaagttcggcaagtactggccggcggatgtacacctggtgggtaag
gatatagtccgtttccatactgtaatctggcctaccattctcatggcggctgaccttcct
ttgcccaaacaggttttcggccacgggtggctgatgctggaaggcggcaagatgtcgaaa
tccaagggcaatgtggttgaccctctgattctggtggaaaagtacggtgtagactctatc
cgctactacctgttgaaggaactcaattacgggatggatggctactattcagaagaaatg
ctgatagcccgcatcaactcggatttggccaatgatttgggtaacctggtcagccggacc
atcgggatgatagaacggtactgccagggcgtgatcccggtaccaggcccacaagaaggg
ctggatcaagaactggtggatactgcagccgctgtctacggcgaagtgggccggcagctg
gaccgtttggatttttcttctgctttgggtgctgtgtggcggctgatttcccgggctaac
aagtacatcgacgagtcggcaccgtggttgctggcccgggatgaagctaagcgagaacgc
ctgaatacggttctttataacctagccgaggtcatccgcattactggtataatgttggcg
ccatttatgcccaccctgccagggagaataaaccggcagattccggtatttgacgatccc
gagcaactgaggtggggcgaagccgggaagtggggactgctagtgtccggcagaaaggtg
gcaaaaggcgagtccctgttcccgcggattgacttaaagactttggaaaaggatgacaag
gaaacctcggccgaacctattgcagccgaaccggggcccgaggtgaatgacttgcaggaa
ttcataaccatagatgagttcgcgcgcgtccatctccgggtagcagaagtaatagcggcg
gagaagatgaagaaggcagacaagctgctggttcttaaggtgaggctgggggaagaagag
cgaaccatagtagccggcattgctcagcactacacccccgaggagctcgtcggcaagaag
atcgtagtggtagcgaatctgaaaccgaccaaattaaggggagtcgaatcgcaagggatg
ttgctggccgcctctaatgaagaggggctggctatcctcaccttggaccgggatcttccc
tctggttgcaagataaagtga

DBGET integrated database retrieval system