KEGG   Syntrophothermus lipocalidus: Slip_0101Help
Entry
Slip_0101         CDS       T01253                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00900  Terpenoid backbone biosynthesis
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01130  Biosynthesis of antibiotics
Module
slp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Slip_0101
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Slip_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADI00901
UniProt: D7CIN6
Position
107766..108785
Genome map
AA seq 339 aa AA seqDB search
MPGLWLITGVGGLAFFFGYNIIEAVDKAANEEGKTMLKTVTIEAPAKINLTLDVKGRRPD
GYHEIETVMHQIDLVDRVSLRVSSEGIKVTADSPELPCAEDNLAFRAAVEFFRQVGATGG
VEVFIHKRIPVGAGLAGGSSDAAAVIKGLNRLYGDRLTPDEMLDLGAKIGSDVPFCILGG
TALARGRGEIVTPLFTDMTLALVLVKPDFAVSTKEVYERFDKVQIFERPDTDEVMRGLLC
KDVEMICRGMGNVLEAVTTAWFPEVARIKQRMKGLGAIAALMSGSGPSVFGVFQEEGVAR
EAFGRFKLEYREVYLTKSYRKGEGKDAGKQTDSCETGHV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggtctgtggctcattactggggtcggtggactggcgtttttttttgggtacaat
ataattgaagctgtagacaaagctgcgaatgaagaaggcaagaccatgctcaaaacagtg
acaatagaagcaccggctaagataaacctcacccttgatgttaaggggcggcgtcccgac
gggtaccatgaaatcgaaaccgtaatgcaccagatagacttggtggacagagtatccctg
cgagtaagttctgagggtatcaaggttactgccgattcgcctgagctcccttgcgcggaa
gacaacctggctttccgggcagctgtagagttttttaggcaagttggtgctaccggcggg
gtcgaagtattcatccacaagaggatcccagtaggagccggccttgccgggggcagcagc
gatgcggctgctgttataaaggggcttaaccggttgtatggggacaggcttacaccggat
gagatgctggatctgggggcgaagataggctccgacgttccgttttgtattttggggggc
acagctcttgcccgggggaggggagagatagtcacaccgctgttcactgatatgacgcta
gctttggtgctggtaaaaccggattttgcggtctcgaccaaagaggtttacgaaaggttc
gacaaagtgcagattttcgagcgccccgatacagacgaggtgatgcgcgggctcttgtgc
aaagacgtagaaatgatttgtcggggaatggggaacgtcctggaagcggttacgactgca
tggtttccggaggtggcccgtatcaaacagcggatgaaaggacttggggcgatagcggct
ctgatgtcaggaagcggtcctagcgtctttggggtgtttcaagaagaaggagtagccagg
gaggctttcggccgtttcaagctcgaataccgagaggtatacttgacgaagtcttataga
aagggtgagggaaaggatgccggaaagcagactgattcctgtgaaactggacacgtataa

DBGET integrated database retrieval system