KEGG   Syntrophothermus lipocalidus: Slip_0468Help
Entry
Slip_0468         CDS       T01253                                 

Definition
(GenBank) Benzoyl-CoA reductase
  KO
K04113  benzoyl-CoA reductase subunit B [EC:1.3.7.8]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00362  Benzoate degradation
slp01100  Metabolic pathways
slp01120  Microbial metabolism in diverse environments
slp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Slip_0468
Enzymes [BR:slp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     Slip_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGD-D
Motif
Other DBs
NCBI-ProteinID: ADI01252
UniProt: D7CKL7
Position
469914..471221
Genome map
AA seq 435 aa AA seqDB search
MSTAEPKKANRVKSGKLVNKLVNEYWEDLIHAKEAGKLVVYTTGLPIGPFMAAQDMAWIH
GEGYGARVAARHEEKEPQIYAERRGYNREICSYARTQLGCVMFAERGIPEDLPAGPIAAQ
IPPPDAIVTCYPGCSSGPQWDWSIERLWGKKIPWFNVVIPYHMGRNGSGYMSGQEFQDEV
AYIVRQFKDLIRWLEELSGRPYNWDKFCELMAVTKKVGKLRMEAMELAGKTVPSPASFFD
WSQFIAPVNYLTAWPGTIECMQAVKEEVQERIANGVTAVPNEKYRLFWEGIMNWNKLGWM
ANKFANYDACVVAGRYTHMAFWQEPDVIDPEDPLEGIAINHLECQLNLGYPITIERMKKL
CREYAIDGVILHGARTCRSFARSHYLMAEELMRTMGIPSTMFEGDMVDESFYIDELVNTR
IEALLETLEAKKSRN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtacggcagaaccgaagaaggctaatcgcgtaaaatcgggcaagctggttaacaag
ctcgtaaacgaatactgggaagacctgatacatgccaaagaagcgggcaaactagtggtc
tacactacaggactacctatcggcccgttcatggcagcacaagacatggcctggatacat
ggcgagggttacggggcccgcgttgccgccaggcatgaggagaaggaaccgcagatttat
gctgagagacggggatataaccgggagatctgttcatatgcccgaacccagctaggctgt
gtgatgttcgccgaaagaggtattcctgaggatctacctgcgggtcccatcgcagctcag
atacctccgccggacgctatcgttacttgttatcccggctgttccagcggaccacagtgg
gactggtctattgaacggctatgggggaagaaaataccatggttcaacgttgttataccg
tatcacatggggcgcaacggctccggctacatgagcggtcaggagttccaggacgaggtt
gcatatatagtgaggcagttcaaggatctcatccggtggttggaagagctcagcggtcgt
ccatacaactgggacaagttctgtgaactgatggcggtcactaagaaagttggaaagctc
cgcatggaagccatggagctagcaggtaagaccgtcccttcacccgcgagtttcttcgat
tggagtcaattcatcgctccagtgaattaccttacagcgtggccggggacaatagagtgt
atgcaagcagttaaagaagaagttcaggaaaggatagccaatggagtaacggcggttccg
aatgaaaagtaccggctcttctgggaaggaataatgaactggaacaagctagggtggatg
gcgaacaagtttgcgaattacgatgcgtgcgtggtggctggccggtatactcatatggct
ttctggcaggagcccgacgtgattgatccagaggatcccctcgaagggatagctattaac
cacctggaatgccagcttaacctaggatatcctatcactatcgagaggatgaagaagctc
tgccgggaatatgccatcgatggggtgattctccacggggctagaacttgccgttccttc
gcccggtcacattatttgatggccgaggaattgatgaggactatggggatacccagcacc
atgttcgagggcgatatggttgatgagtcgttctacatcgacgaactcgtcaacacgcgt
attgaggcgttactcgaaacactcgaagccaagaagagcaggaactaa

DBGET integrated database retrieval system