KEGG   Syntrophothermus lipocalidus: Slip_1429Help
Entry
Slip_1429         CDS       T01253                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00860  Porphyrin and chlorophyll metabolism
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slip_1429
Enzymes [BR:slp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Slip_1429
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Slip_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M CysG_dimeriser Ist1 Pyr_redox_3 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ADI02192
UniProt: D7CNA7
Position
complement(1485135..1485818)
Genome map
AA seq 227 aa AA seqDB search
MRKTLFRGEDVYGTKHLFPIFLDIQGRECLVVGGGDVALRKVKSLLQCGARVKVVAPEMA
SGVQTLAGEPGLTMIRKGFEETDLDGVFMVFCATDQDEVNASIARLCERRGILVNVVDKP
EECTFIVPSVLRRGPLSIAVSTGGNSPLWARRVRELLESVITDEYGEFTEMLGAARDLVK
KTYPDDIARRQQVFQSLVDSDIFQLLRSGQKEKAKERMEQCIFSLPG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaagacccttttccgtggtgaggacgtgtacggcacgaaacatttgttcccaatc
tttctagatattcaaggtcgcgagtgtttggtcgtaggcggcggggacgtggctctgcgt
aaggttaagagccttctgcaatgtggagcgagggtcaaggttgtagccccggaaatggca
tcgggggttcagacgctggctggtgagcccggattgaccatgatccggaaggggttcgag
gagacagacctcgacggggtttttatggtgttttgtgccacggaccaagacgaggtaaac
gcgtccattgcccgcctttgcgaaaggcgggggatactcgtaaacgttgtagacaaacca
gaggaatgtaccttcatagtgccatcagtgctcaggaggggacccttatccatagccgta
tcaactgggggtaatagccccttgtgggcaagaagggtgcgggagctactggagtcggtt
attaccgatgaatacggtgagtttacggaaatgttaggggctgctcgtgacctcgttaaa
aaaacgtatcccgatgatattgcccggcgccagcaggtttttcagagtcttgttgattcg
gatatatttcaattactccggtccggtcagaaagagaaagcaaaggagcggatggaacag
tgtatattctccttaccgggctaa

DBGET integrated database retrieval system