KEGG   Syntrophothermus lipocalidus: Slip_1859Help
Entry
Slip_1859         CDS       T01253                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00010  Glycolysis / Gluconeogenesis
slp00052  Galactose metabolism
slp00500  Starch and sucrose metabolism
slp00520  Amino sugar and nucleotide sugar metabolism
slp00521  Streptomycin biosynthesis
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01120  Microbial metabolism in diverse environments
slp01130  Biosynthesis of antibiotics
slp01200  Carbon metabolism
Module
slp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slip_1859
   00052 Galactose metabolism
    Slip_1859
   00500 Starch and sucrose metabolism
    Slip_1859
   00520 Amino sugar and nucleotide sugar metabolism
    Slip_1859
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slip_1859
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Slip_1859
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Slip_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADI02613
UniProt: D7CPH8
Position
complement(1913791..1914861)
Genome map
AA seq 356 aa AA seqDB search
MRLMKVAPRENGSPLKARSWIVGVDLGGTKILAGLGDTEGNIRAELKVATRAEEGPERVV
GRIAQTVCELLQHTGVKEKEIGAMVVGAPGPLDPSSGIVYQPPNLPGWDSFPLKERLSGY
FPDFPVMIDNDANLAALGEYRFGYQQVFDNLLFMTVGTGIGGGIILDGRIHHGACGAAGE
FGHMVILPEDGPLCGCGNHGCLETLASGTAIAREARDMVRAGKGALLWELAGRDMERLTA
EVVGEAARKGDEAASEIIARAGYYLGIGLANLVNIFNPAAIVIGGGVVSGLGELLLVPAR
EEMKRRAMKLQGEKVQVLRGKLGTRAGLLGCFALAAQKYPTTPNLCQSVAEIKEGF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgatgaaggtcgcaccgagggaaaacggctcaccactgaaggcacgttcctgg
attgtgggggtggatttgggcgggaccaagatcctggcgggattaggcgataccgaaggc
aatatcagggcggagcttaaggtcgctaccagagcagaagaaggcccggaaagggtagta
ggacgaatagcacaaacggtgtgcgaactgcttcaacataccggggtgaaggaaaaagag
atcggagctatggtagtaggggcaccggggcctctcgatccttcgtctggtatcgtctac
cagccacctaaccttccggggtgggacagttttcccctaaaagagaggttgtccggttat
tttccggacttcccggtgatgatagacaatgacgctaacctggcagctttgggcgagtat
cgtttcggttaccagcaggtttttgacaacctgctctttatgactgtggggaccgggatc
ggcgggggaatcatcctggacgggcgaattcatcatggagcctgcggggcggcgggggaa
ttcggccatatggtgatactgccggaagacggtcccctttgcggatgtggaaaccacggc
tgtctggaaacgctggcttcgggaacggccatagcgcgggaagcccgggacatggtaaga
gccggcaaaggggctttgctgtgggaactggcaggccgcgatatggagcgcttgactgca
gaggtggtcggggaagcggcaagaaaaggagacgaagcggctagcgagatcatcgcccgg
gctggatactatctgggaatcgggttggccaatctggttaatattttcaacccggcagcc
atagtcataggaggaggggttgtctctggtttgggagaattactgctggtacccgcccgg
gaggaaatgaagcgacgggccatgaagcttcaaggcgagaaagtgcaggtattgcgaggt
aaactgggtactcgcgccgggctgttaggatgtttcgcgctggccgcccaaaaatatcca
accacgcccaatctgtgtcaatctgtggctgaaatcaaggagggattttga

DBGET integrated database retrieval system