KEGG   Syntrophothermus lipocalidus: Slip_1988Help
Entry
Slip_1988         CDS       T01253                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00071  Fatty acid degradation
slp00280  Valine, leucine and isoleucine degradation
slp00362  Benzoate degradation
slp00620  Pyruvate metabolism
slp00630  Glyoxylate and dicarboxylate metabolism
slp00640  Propanoate metabolism
slp00650  Butanoate metabolism
slp00900  Terpenoid backbone biosynthesis
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01120  Microbial metabolism in diverse environments
slp01130  Biosynthesis of antibiotics
slp01200  Carbon metabolism
slp01212  Fatty acid metabolism
slp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Slip_1988
   00630 Glyoxylate and dicarboxylate metabolism
    Slip_1988
   00640 Propanoate metabolism
    Slip_1988
   00650 Butanoate metabolism
    Slip_1988
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Slip_1988
   00072 Synthesis and degradation of ketone bodies
    Slip_1988
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Slip_1988
   00310 Lysine degradation
    Slip_1988
   00380 Tryptophan metabolism
    Slip_1988
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Slip_1988
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Slip_1988
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Slip_1988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slp04147]
    Slip_1988
Enzymes [BR:slp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Slip_1988
Exosome [BR:slp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Slip_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADI02739
UniProt: D7CPW1
Position
2033313..2034530
Genome map
AA seq 405 aa AA seqDB search
MPDNEVVIIASARTPFDRFGGVTKNVPSAVLAEWTITELLKRSGLEPQMIDEVNLGQCLL
LEAGTQTDIIARQALIRAGLPQETLSMSIDRACCSSTTALQESWKNLMIGEAEISMAIGV
ENMSRVPYYLPPEYRWEGPRLGNAKLVDILFQLGYAGFGVLAVDAGEVAVEYGVTREMQD
EWALRSHKLYAQAEARGIFKEEIFSIQIPQGKKKPPVILDRDTQPRPDTTLEELAKLPTV
YGSPTVTPGNAPGMNTGAAGVVVTTRKKAQELGLKPLATLLRVVSIARPAREIAIAPAPA
IQKGLAATGLTLDDIKLIEINEAFAAMPLVSTKILGDFDEAKVKKLRDITNVNGGAIAIG
HPVGASGLRITLTLVNELRRRGGGYGVAAICGGLAQGDCAVVKVD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaacgaagtggtgataatcgcttcggcgcgcacgccttttgaccgctttggc
ggcgtaactaaaaatgttcccagcgccgtgctggcagagtggacgataaccgaactgttg
aaacggtccggactggaaccccagatgatcgacgaggtcaacctggggcagtgcctgctt
ctggaagccggaacccagaccgacatcatcgcccgccaggctttgataagagctggcttg
ccgcaagaaaccctatctatgagcatcgaccgggcttgctgctcatccacgaccgccttg
caggagtcatggaagaacctgatgataggcgaggccgagatcagcatggccataggggtc
gaaaacatgagccgagtcccatattacttgcctcccgagtaccggtgggaaggcccccgt
ctggggaacgccaagctggtggatatcctttttcaactgggttacgcgggctttggggtt
ctggcagtcgacgcgggggaagtggccgtcgaatacggcgtaacccgcgagatgcaggac
gaatgggccttacgcagccacaagctgtatgcccaagccgaagcccggggaatattcaaa
gaggagatattttcaattcaaataccccagggtaagaaaaaaccgccggtaatactggat
cgggacacccagccccgcccggataccactttagaggaactcgccaaactgccaacggtg
tatgggagccctaccgtcactcccggtaacgctccgggaatgaatacgggcgctgccggt
gtggtcgtgactaccagaaaaaaagctcaagaactggggttaaagcctctagcaaccctg
ctgcgggtggtgagcatcgcccgcccggcccgagaaatcgccatcgctcccgctcctgct
attcagaagggtttggccgcgactggcctgacgttagatgacatcaaactcatagaaatc
aatgaggcttttgcagccatgcccctggtttccaccaagatcctgggtgatttcgatgaa
gctaaggtaaaaaagcttcgcgacattactaatgtcaacggcggggcgatagccatcggt
cacccggtaggagcgagcggtctccggataaccctaaccttagtgaacgagcttcgccgc
cggggaggtggatacggggtcgctgccatctgcggagggctggcccagggggactgcgcg
gttgtgaaagtggattga

DBGET integrated database retrieval system