KEGG   Syntrophothermus lipocalidus: Slip_2059Help
Entry
Slip_2059         CDS       T01253                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00860  Porphyrin and chlorophyll metabolism
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slip_2059
Enzymes [BR:slp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Slip_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase MCM AAA GAT Sigma54_activat AAA_30 AAA_5 P-mevalo_kinase AAA_16 AAA_2
Motif
Other DBs
NCBI-ProteinID: ADI02806
UniProt: D7CIS8
Position
complement(2091865..2093067)
Genome map
AA seq 400 aa AA seqDB search
MKPYLKLARHDGNRTLFDLVEMSVISTYCGEPFHLHAEGLRGTGKTTIMRAARDILPPIK
RIKGCIYNCDPQAPHCPMHRDLTPTEIEAIGVEEIPMPFLEISHSAKVGTVAGSIDLAKI
TDQNHPQAALLPGIIPQAHRGIIFIDEINRLADTSPEITDILLDVMGNKPGRLQIEEAGL
PVVEISITVSVWAASNPDEEPGPLEEVRRQLSDRFDMVYYMGRPGSVEVVSQMLQNSRAM
KTGANLEELESANQEYRQRIIEMAARYAEADVPDFVRNFIARVYVKHNLESLRAVEAIQQ
GAILHSILKKRNQVTVADVIEMIPLGLKHRVDGDTLVKIMNSLESRSPKESILSLRDKRE
KGKTGRESNEELFEPGARRLRDISRSELIATEKALNPSDF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatacctgaaacttgccagacacgatgggaaccggaccctgtttgatttggta
gaaatgtccgtaatctctacctactgcggagaacctttccaccttcatgcagaaggactg
cgtggaaccggtaagacaaccattatgcgggcggccagagatatccttcctccgatcaag
cggatcaaaggttgtatttacaactgtgacccccaagctccgcactgtccaatgcacagg
gatttaactccgaccgaaatcgaggccattggagtagaagaaataccgatgccgtttttg
gaaatatcgcattcggccaaggtgggtacggtcgcaggaagtatcgatttggcaaagatc
acggatcagaatcatcctcaagcagcgcttttgccaggcattatacctcaggctcaccgg
ggcatcatctttatcgacgagatcaaccgtttagctgatacctcgcccgagataacggat
atcctgctagacgtgatggggaacaaaccaggccgcctgcagatcgaagaagcggggtta
ccggtggtggagatatccatcacggtgtcggtatgggccgcctccaacccggacgaggag
ccgggaccgttggaggaggtcaggcggcaactctcggaccggtttgacatggtttattac
atggggaggccggggtcggtagaagtggtctcccagatgttgcagaactcgagggctatg
aagacaggcgcgaaccttgaagagttggaatcggccaaccaggaatacaggcaaagaata
atagaaatggcggcgcgttacgccgaggcagatgtaccagactttgtccgcaacttcatc
gccagggtgtacgtcaaacacaacctggaaagcctgcgggcggttgaggccatccaacaa
ggagctattttacacagcatcctgaaaaaacggaaccaagttacggttgctgacgtgatc
gagatgatcccgctgggactcaagcacagggtagacggggataccttggtcaagataatg
aacagtctggagtcgaggtctcccaaagaaagcatcttgagcctgcgggacaagagggaa
aagggtaagacgggtcgagaatcgaacgaagagctttttgagccaggagcccgaagactt
agagatatcagcaggagtgaattgatcgcaaccgaaaaggcactgaaccccagcgatttt
tag

DBGET integrated database retrieval system