KEGG   Serratia liquefaciens: M495_04420Help
Entry
M495_04420        CDS       T02740                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
slq  Serratia liquefaciens
Pathway
slq00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M495_04420
Enzymes [BR:slq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     M495_04420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: AGQ29710
Position
953547..954233
Genome map
AA seq 228 aa AA seqDB search
MNRSAVNQILQQTQHFFARFDVHLPPFAHFSPTVWRQLDRQPWQEVFDLKLGWDVTAFGG
EDFAHKGLTLFTLRNGSPGGQPYAKCYAEKIMHCREAQVTPMHFHWRKREDIINRGGGNL
IVELHNADPQEGLADSPVSVTLDGCRQTHAAGSRLRLAPGESICLTPGIYHSFWGEEGFG
DVLVGEVSTVNDDDNDNRFLTPLSRFSQIEEDQPPQWLLCNEYLRFID
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttccgccgtgaaccagattctgcaacaaacccagcatttttttgcccgcttc
gacgtccatctgccgccctttgcgcactttagcccaaccgtctggcgtcagctcgatcgt
cagccgtggcaggaggtattcgacctgaagctgggttgggacgtcacggcgttcggcggt
gaggattttgctcacaaggggctgacgctgttcacgttgcgaaacggttcgcccggcggt
caaccttatgccaaatgctatgcggagaaaatcatgcattgccgcgaagcacaggtgacg
ccgatgcatttccactggcgcaagcgggaagacatcatcaatcgcggtggcggcaacctg
atcgtcgagctgcataacgccgatccgcaggaagggctggccgacagcccggtgagcgtg
accctggacggttgccgacagactcacgccgccggttcacgcctgcggctggcgccgggg
gaaagcatctgcctgacgccgggcatctatcacagcttttggggcgaggaaggtttcggc
gacgtgttggtgggtgaggtttcgacggtgaatgacgatgacaacgataaccgtttcctg
acgccgctcagccgctttagccagatcgaagaggatcagccgccccagtggttgctgtgt
aacgaatacttgcgctttatcgattaa

DBGET integrated database retrieval system