KEGG   Serratia liquefaciens: M495_07525Help
Entry
M495_07525        CDS       T02740                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
slq  Serratia liquefaciens
Pathway
slq00051  Fructose and mannose metabolism
slq00520  Amino sugar and nucleotide sugar metabolism
slq01100  Metabolic pathways
slq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M495_07525 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    M495_07525 (cpsB)
Enzymes [BR:slq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     M495_07525 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding CENP-C_C DUF4437 Cupin_3
Motif
Other DBs
NCBI-ProteinID: AGQ30307
Position
1599014..1600438
Genome map
AA seq 474 aa AA seqDB search
MSKLIPVVMAGGTGSRLWPLSRESFPKQFLSIDDSGFSLLQQTLQRLSGLDGVKVAAPLV
ICNENHRFLVAEQLREIDQLATNIILEPVGRNTAPAVALAAHLAAEEDEDSILLVLAADH
LIKKVDNFHSAIKTAIQHASEDHLVTFGIIPEHPETGYGYIKRGSALSDECFKVDAFVEK
PSLDKAVEYLASGEFSWNSGMFMFKTDKFLQELQQFSPEIFSTTQQSVADSQRDMNFIRV
DQEIFKHCPSDSIDYAVMEKTGDAVVIPIDAGWSDVGSWSSLWDVSEKDHLGNVNVGEII
SIDSTDNYISSESALVATIGLDNLIVVNTNDALLIASKDRVQDVKKVVDELKKRKLHHFR
KHSSSYQPWGKISEIDNGNYYQVKKIVVRPSEGLSVQRHHHRSEYWVVVSGTAKVQVDDK
EFYLTENQSTFIPAGSVHTLENRGKIDLEMIEVRSGQYLGDDDIERLHDRYGRK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaattcctgtggttatggccggtggcactggaagccggctgtggccgctg
tcgcgcgaatcatttccaaaacaattcctctctatagatgacagtgggttcagtttgctg
cagcaaactttgcagcgtttgtctgggttggatggggttaaagtggctgcacctttggtt
atctgcaatgaaaaccatcgttttctggttgcggaacaactacgcgaaattgatcaactt
gccactaatattattttagagcctgttgggcgcaacaccgctccagcggtggctttggct
gctcatctggctgcagaagaagacgaagacagcatattgctggttttggctgccgaccat
ttgattaaaaaggtggataatttccactcggcaataaaaacggccattcagcatgccagc
gaagatcatttggtgactttcggcattattccagagcacccggaaacgggttatggctat
atcaagcgcggtagtgcgctctctgacgaatgcttcaaagtcgatgcatttgtcgagaaa
cctagtttggacaaggccgttgaatacctggcaagcggtgagtttagctggaacagcggc
atgttcatgttcaaaactgataaattcctgcaagagctgcaacagttcagtccggaaatt
tttagtaccacgcaacagtccgtcgcggatagtcagcgcgatatgaactttatccgtgtc
gatcaggaaatattcaagcactgcccaagtgactcgatagattacgcggtgatggaaaaa
acaggtgatgcagtggttattcctatcgatgctggttggagtgacgtaggctcctggtca
tcactgtgggatgtttcagaaaaagatcacttggggaacgtaaatgttggcgaaattata
tccatagattcaactgacaactatatttcttcggagtctgcactggtagctactattggg
cttgataatctgattgtggtcaatactaacgatgcattgctgattgctagtaaagatagg
gtgcaagatgtgaagaaagtggtggatgagcttaagaaacgcaagcttcaccacttccgt
aaacactcttcttcataccagccttggggaaagattagcgagattgacaacggtaattat
taccaagtaaaaaaaattgttgtgcgtccgtcggagggattgtctgttcaacgtcatcac
catcgttccgagtactgggtagtagttagcggtacagctaaagttcaggtagatgataaa
gagttttacctaacagaaaatcaatctacttttatccccgcaggtagtgttcataccctt
gagaatagagggaaaattgacttggagatgattgaggtcagatccgggcaatatcttggc
gacgatgacattgagcgattgcatgaccggtatgggagaaaataa

DBGET integrated database retrieval system