KEGG   Serratia liquefaciens: M495_08550Help
Entry
M495_08550        CDS       T02740                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
slq  Serratia liquefaciens
Pathway
slq00040  Pentose and glucuronate interconversions
slq00053  Ascorbate and aldarate metabolism
slq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M495_08550
   00053 Ascorbate and aldarate metabolism
    M495_08550
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     M495_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PAC4
Motif
Other DBs
NCBI-ProteinID: AGQ30503
Position
complement(1831763..1833373)
Genome map
AA seq 536 aa AA seqDB search
MSNAHTISGQQFIGGQRRASGEAQLVSLRADNGLPTGHVFFSASHEEAAAAADAAAQAFT
AYSQLSAERRADFLEAIADQLDALDEDFFGFAMQETALPLARLSGERARTSGQMRLFATL
LRRGDVHGVRIDSALPQRTPVPRLDLRQYRTALGPVAVFGASNFPLAFSTAGGDTAAALA
AGCPVVFKAHSGHMITAELTALAIERAREQQQIPAGVFNMIYGDHIGAELVQHPAIQAVG
FTGSLRGGRALFDLAQRRAQPIPVFAEMSSINPLIVMPQALARRGQQIARELVASFTLGC
GQFCTKPGLIIGQRGEAFSEFVRELSAQVNAAPAQAMLNAGTLANYRRGLAALDEQNGIR
HLAGHREERPHLATAQLYQADFDLLLSGNPLLQEEVFGPAAILVEVEDRRQLTAALDSLQ
GQLTATLLTENEDLADAEPLAQRLAQKAGRVLFNGYPTGVEVCDAMVHGGPYPATSDARG
TSVGTLAIERFLRPVCLQNYPPALLPPQLQDSNPLGLLRLVNGIYTREPLRSPAND
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcccataccatcagcggccaacagtttatcggcggtcaacgccgtgccagc
ggcgaggcccagcttgtcagcctgcgcgccgacaacggtctgccgaccggccacgttttt
ttctcggccagtcacgaagaagccgccgccgccgccgatgccgccgcacaagcattcacg
gcctattctcagctcagcgccgagcgtcgagccgactttcttgaggccattgccgaccaa
ttagacgctctggatgaggatttcttcggcttcgccatgcaggaaaccgccctgccatta
gcccgactgagcggcgaacgggccagaaccagcggccaaatgcgactgtttgccaccctg
ctgcgccgtggggatgtgcatggcgtgcgcatagacagcgcattgcctcaacgaacgccg
gtgccccgcctggatctgcggcagtatcgcaccgccctcgggccagtggcggtgtttggt
gccagcaatttcccattggcattctccaccgcaggcggagacaccgcggccgcgttagcc
gcaggctgtccggtggtgttcaaggcgcacagcggccatatgatcaccgcagaactgacc
gcactggccatcgaacgggcaagagaacaacagcagatccctgctggggttttcaacatg
atttatggggaccacattggcgcggaactggtgcagcatccggccattcaggcggtgggt
ttcaccggatcgcttcggggcggccgggccttgttcgatttggcccagcggcgcgcccaa
ccgatcccggtatttgccgagatgtcgagcatcaacccgctgatcgttatgccgcaggct
ttagcccgccgtgggcagcagatcgcccgcgagctggtcgcatccttcaccctcggctgc
ggccagttctgcaccaagcctgggctgatcatcgggcaacgcggcgaagcattcagcgaa
tttgtgcgcgaactgtccgcacaggtcaacgccgcgcctgcgcaagccatgctcaatgcc
ggcacgctggccaattaccgccgcggattggctgctcttgatgagcaaaacggcatccgt
cacctggctggtcatcgcgaagagcgcccgcatttagcaacggcacagctctatcaggcc
gatttcgatttgctgctcagcggaaacccgctgctgcaagaggaagtgtttggcccggca
gccattctggtggaagtggaagatcgtcgacagctgactgccgcactggacagcctgcag
gggcaactgaccgccacgctgctgacagaaaacgaagatctggccgacgcagaaccgctg
gctcaacggctggcccaaaaagcggggcgggtgttgtttaacggttatccgaccggggta
gaagtctgcgatgccatggtgcacggcgggccttatccggccaccagcgacgcacgcggt
acttcggtgggtacgctggctattgaacgttttctgcgcccggtctgcctgcagaattac
cccccagcgttgctgcccccgcagctgcaagacagcaatccactgggcctgctgcggctg
gttaacgggatttacacccgtgaacctctccgctcaccagccaacgactaa

DBGET integrated database retrieval system