KEGG   Serratia liquefaciens: M495_10100Help
Entry
M495_10100        CDS       T02740                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
slq  Serratia liquefaciens
Pathway
slq00052  Galactose metabolism
slq00500  Starch and sucrose metabolism
slq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    M495_10100
   00500 Starch and sucrose metabolism
    M495_10100
Enzymes [BR:slq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     M495_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGQ30782
Position
complement(2125774..2127216)
Genome map
AA seq 480 aa AA seqDB search
MKNALAQADHAVEALRAQRQDDYYPQFHLAAAAGWINDPNGLVYINGVYHAFYQHHPYDQ
NWGPMHWGHATSRDLAHWQHQPIALAPGESYDKDGCFSGCAVDDNGVLTLLYTGHVWLGK
EGDDDQVREVQCLATSEDGVNFVKHGPVLLPPEGIQHFRDPKVWRAADRWWMVVGAKENG
LGQARLYRSNDLRDWQFDRVLAGAQSPHQGYMWECPDFFPLGEKQVLLFSPQGLTAQGYR
NRNRFQSGYLLGHWRPDEDFSVTQSFCELDGGHDFYAPQTFTAADGRRMLFAWMDMWESP
MPSKPHGWAGALTLPRELTLSCEGNVLMNPTRELTALRGEQQSFDAVSVRNQRQVLTDGV
QELALTLNVAASDAERYGIVIGTAARLYVDNQTHRLVLERFSEDPGLCGCRSVPLPEADI
LSLRVFIDRSSLEVFVNHGEACLTSRIYPTDGQRSVTLFAEGGLAQFGAAQAWELESIWE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctttagctcaagccgatcacgcggtcgaagcgctgcgcgcgcaacgtcag
gacgattactatccgcaatttcatctggcggcggccgccggttggatcaacgaccccaac
ggtctggtgtacatcaacggcgtctatcatgcgttctatcaacatcatccctatgaccaa
aactggggccccatgcattggggccacgccaccagccgggatctggcgcattggcagcat
cagccgatcgccctggctcccggcgaaagctacgacaaagacggctgtttttccggctgt
gcggtggatgacaacggcgtattgacgctgctctacaccggccacgtctggctgggcaaa
gaaggcgatgacgaccaggtacgcgaagtgcagtgcctggccaccagcgaagatggcgta
aatttcgtcaaacacgggccggtgttgctgccgccggaaggcattcagcactttcgcgat
ccgaaagtctggcgtgcagctgaccgctggtggatggtggtcggcgccaaagaaaacggg
ttaggccaggctcgactttaccgttcgaatgacctgcgcgactggcagttcgatcgcgtc
ctggcgggggcacaatcgccgcaccagggctatatgtgggaatgtccggatttcttcccg
ctcggtgaaaagcaggttctgctgttctcgccgcagggactgacagcgcagggttatcgc
aatcgtaaccgcttccagagcggctatctgctcggccactggcggcccgatgaggatttc
agcgtcacccagtcattctgtgagctggatggcgggcacgatttctacgcaccgcaaacc
ttcaccgccgccgacggtcgccgcatgctgttcgcctggatggacatgtgggaatcgcct
atgccgagcaaaccccacggttgggccggtgcactcaccctaccccgtgaattgacgctg
tcatgtgaaggcaacgtactgatgaatccgacgcgcgagctgacagcgttgcgcggcgag
caacagtcatttgacgccgtgtctgtacgtaaccagcggcaggtgttgactgacggggtg
caagaactggcattgacgctaaacgtcgccgccagcgatgcagagcgctacggcatcgtt
ataggcaccgccgcacggctgtacgtcgataatcaaacgcatcgactggtattggaacgt
ttcagtgaagatccgggcctgtgcggctgccgcagcgtgccgttgcctgaggcggacatt
ttgtcgctgcgcgtctttatcgaccgctcatcgctggaagtgttcgttaatcatggcgag
gcctgcctgaccagccgtatctacccaaccgacgggcaacgcagcgtcaccctgttcgcc
gaaggcggactggcgcagtttggcgcggcacaggcctgggaactggaaagcatctgggag
tga

DBGET integrated database retrieval system