KEGG   Serratia liquefaciens: M495_14025Help
Entry
M495_14025        CDS       T02740                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
slq  Serratia liquefaciens
Pathway
slq00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:slq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M495_14025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slq01007]
    M495_14025
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slq03016]
    M495_14025
   03029 Mitochondrial biogenesis [BR:slq03029]
    M495_14025
Enzymes [BR:slq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     M495_14025
Amino acid related enzymes [BR:slq01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   M495_14025
Transfer RNA biogenesis [BR:slq03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    M495_14025
 Prokaryotic Type
   Other AARSs
    M495_14025
Mitochondrial biogenesis [BR:slq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    M495_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AGQ31545
Position
2955719..2957449
Genome map
AA seq 576 aa AA seqDB search
MNIQVLLSDKVSQALIAAGAPADCEAQVRQSAKAQFGDYQANGVMSVAKKLGMPPRQLAE
KVVQLLDLGDVASKVEIAGPGFINIFLNSDWVAQQTDLVLGAPKLGIAPVKPQTIVIDYS
APNVAKEMHVGHLRSTIIGDAAARTQEFLGHKVIRANHVGDWGTQFGMLIAYLEKMQNEN
ASDMGLSDLEQFYREAKKHYDEDAEFAERARAYVVKLQGGDQYCLKMWRKLVDITMAQNQ
LTYNRLNVTLTEDDVMGESLYNAMLPGIVADLKAKGLAVESEGATVVFLDEYKNKDGEPM
GVIIQKKDGGYLYTTTDIACAKYRYETLGADRVLYYIDSRQHQHLMQAWTIVRKAGYIPD
SLSLEHHMFGMMLGKDGKPFKTRSGGTVKLSDLLDEAVDRAGKLIAEKNPDMPAEEMQSL
ANAVGIGAVKYADLSKSRTTDYIFDWDNMLAFEGNTAPYMQYAYTRVASVFKRAGVDESN
LTLPLVMTEEREIALATRLLQFEEVITTVAREGTPHVMCSYLYDLAGLFSGFYEHCQILN
ADSEEARQSRLKLALLTAKTLKIGLDTLGIETVERM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaggttcttctttcagataaagtcagccaggcgctgattgccgcaggcgcg
ccagccgattgcgaagcgcaggtccgtcagtccgccaaagcgcagttcggcgactatcag
gctaatggcgtgatgtccgtcgccaagaaactcggcatgccgccgcgccaattggcagaa
aaagtggtgcaactgcttgatctcggcgacgttgccagcaaagtggaaatcgccggtccc
ggctttatcaatatcttcctgaacagcgactgggtcgcgcagcaaactgatttggtgctt
ggcgcgccaaaactgggtattgcccccgtcaaaccgcaaaccatcgtgattgactactca
gcgcccaacgtggcgaaagaaatgcacgtcggtcacctgcgctccaccattatcggtgac
gctgcggcacgcactcaggaattcctggggcataaagtgatccgcgccaaccacgtgggt
gactggggtacccagttcggcatgctgattgcctatctggaaaaaatgcagaacgaaaac
gccagcgatatgggcctgtccgatctggagcagttctatcgtgaagcaaagaaacactat
gatgaagacgccgagttcgccgaacgcgcccgtgcctacgtggtaaaactgcaaggcggc
gatcaatactgcctgaagatgtggcgcaaactggtcgatatcaccatggcgcagaatcag
ctgacctataaccgcctgaacgtcaccctgaccgaagacgatgttatgggtgagagcctg
tacaacgcgatgctgccgggcatcgtggccgatctcaaggccaaggggctggcggtagaa
agcgaaggcgccaccgtggtattcctcgacgaatacaagaataaagacggcgagcctatg
ggcgtcatcatccagaaaaaggatggcggctacctgtacaccaccaccgacatcgcctgt
gcgaaataccgctatgaaacgctgggcgccgaccgcgtgctctactacatcgactcacgc
cagcatcaacatttgatgcaggcctggaccatcgtgcgtaaagccggttatatcccagac
tccctctcgctggaacaccacatgttcggcatgatgctgggtaaagacggcaagccgttc
aaaacccgttcaggcggcacggtgaaactgtccgatctgctggatgaagcggtcgatcgt
gcaggtaaactgatcgccgagaaaaacccggacatgccagcggaagagatgcaaagcctg
gccaatgccgtgggaattggtgcggttaaatacgccgacctgtcgaaaagccgtaccacc
gactatatcttcgactgggacaacatgctggcgtttgaaggcaataccgcaccttacatg
cagtatgcttacacccgtgtggcttccgtattcaaacgtgccggtgtcgacgaaagtaat
ctgaccctgccgctggtgatgaccgaagagcgcgaaattgcgctggcgacccgcctgcta
cagtttgaagaagtgatcaccaccgtggcgcgcgaaggtaccccgcacgtgatgtgtagc
tacctgtacgatcttgcgggcctgttctccggcttctacgaacactgccagatcctgaat
gcagacagcgaagaagcgcgccagagccgcctgaagctggcactgttaactgccaaaacg
ctgaaaatcggtctggatacgctgggtatcgaaaccgtcgaacgtatgtaa

DBGET integrated database retrieval system