KEGG   Serratia liquefaciens: M495_24005Help
Entry
M495_24005        CDS       T02740                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
slq  Serratia liquefaciens
Pathway
slq00670  One carbon pool by folate
slq01100  Metabolic pathways
slq01120  Microbial metabolism in diverse environments
slq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    M495_24005 (metF)
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     M495_24005 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AGQ33387
Position
complement(5063995..5064888)
Genome map
AA seq 297 aa AA seqDB search
MSFFHANQREALNQSLAELNGQINVSFEFFPPRTSEMEDTLWQSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRTGLDAAPHLTCIDASPAQLREIATDYWNSGIRHIVALRGD
LPPGSGKPDMYATDLVALLKEVGDFDISVAAYPEVHPEAKSPQADLINLKRKIDAGANRA
ITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQRFATMTNVRVPSWMTSMFE
GLDDDAETRKMVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPVAA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttccacgcaaaccagcgggaagcgctgaatcagagtctggcggagttaaac
ggccagattaacgtatcatttgaattcttcccgccgcgcaccagcgagatggaagacacc
ctgtggcaatccattgaccgcctgagcagcctgaagccaaaatttgtttccgtgacctat
ggcgctaactccggcgagcgcgatcgcacccacagcatcatcaaagggatcaaggatcgc
accggtctggatgcggccccacacctgacctgcatagatgccagcccggctcagctgcgt
gagattgcgaccgattactggaacagcggcatccggcatatagtggcactgcgtggcgac
ttgccaccgggcagcggcaagccggacatgtacgcgaccgatttggtggccttgctgaag
gaggttggcgatttcgatatctcggttgccgcttaccctgaagtgcatccggaagcgaaa
agcccgcaggcggacctgattaacctgaaacgtaaaatcgatgccggcgccaaccgggcg
attacccagttctttttcgatgtggaaagctacctgcgcttccgcgatcgttgcgtcgct
accggcattgatgtggaaatcgtcccgggcattctgccggtatccaacttcaagcagctg
cagcgttttgccaccatgaccaacgtacgcgtaccgagctggatgaccagcatgtttgaa
gggctggatgacgacgcggaaacccgcaaaatggtcggcgccaatatcgcgatggatatg
gtgaagatcctcagccgcgaaggggtaaaggatttccacttctatacgctcaaccgtgcc
gagatgagctacgccatttgccatacgctgggtgtgcgtccggtcgcggcctga

DBGET integrated database retrieval system