KEGG   Salinispira pacifica: L21SP2_0852Help
Entry
L21SP2_0852       CDS       T03013                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slr  Salinispira pacifica
Pathway
slr00020  Citrate cycle (TCA cycle)
slr00480  Glutathione metabolism
slr01100  Metabolic pathways
slr01110  Biosynthesis of secondary metabolites
slr01120  Microbial metabolism in diverse environments
slr01130  Biosynthesis of antibiotics
slr01200  Carbon metabolism
slr01210  2-Oxocarboxylic acid metabolism
slr01230  Biosynthesis of amino acids
Module
slr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L21SP2_0852
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L21SP2_0852
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     L21SP2_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh TT1725
Motif
Other DBs
NCBI-ProteinID: AHC14272
UniProt: V5WEN2
Position
complement(913374..914837)
Genome map
AA seq 487 aa AA seqDB search
MKKITVARGDGIGPEIMDATLKILSAAKAEIEPEFIEIGKSQYLAGNSNGMNQDAWNSIR
KNRIILKAPVTTPQGGGYKSLNVTIRKTLGLFANVRPCRSFTPYVETYHPHLDVVIVREN
EEDLYAGIEHRQTIDVAQALKLISRPGSERVIRYAFEYARAYGRKKVTVMIKDNIMKISD
GLFHRIFNEIKEEYPEIESEQQIIDIGTARLASAPERYDVVVTPNLYGDIISDVVAEISG
SVGMNGSANIGKNAAMFEAIHGSAPDIAGRKLANPSGLINAAVMMLVHIGMPDTGRRIEN
AWLKTIEDGIHTAEIYSDGHSTHLANTDEFADAVIDRLGSNPGFFHGAEFSSDMPAIKIP
DYQRPDVKKVLAGVDVFIDHGSISPDELGNTLSDIAGAARSSLLLKVITNRGVKVYPQGF
PETFTTDHWRCRFLMEKPPVSTDMEGLEPESVIEIQQLIMGAGLEIIKTENLYYFDGEPG
YSLAQGE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaccgtggcacggggagacggtatcggaccagagatcatggacgccacc
ctgaaaattctatcggcggcaaaagcggagattgaaccggaattcatcgagatcggaaag
agccagtatctggcggggaacagcaacggaatgaatcaggatgcatggaacagcatcaga
aagaaccgcatcattctgaaagcacctgttacaactccccagggcggcggctacaaaagc
ctgaacgtgacaattcgcaaaactctgggactgtttgccaacgtacgtccctgccgttca
ttcactccctatgttgaaacgtaccacccccatctggatgtggtgattgtacgggaaaat
gaggaagatctctacgcaggaattgagcatcgtcagactattgatgtggcccaggccctg
aagctgatttcccggcccggcagcgaacgggttatccgctacgccttcgaatacgcccgg
gcgtacggcagaaagaaagtcacggtgatgatcaaggataatattatgaagatcagtgac
gggctgttccatcgcatcttcaacgagattaaggaggagtatccggaaattgaaagcgaa
cagcagatcatagatatcggaaccgcccggctggcatccgcgccggaacgctacgatgtg
gtggtaacgcccaatctgtacggcgacatcatctccgatgtggttgcagaaatttccggt
tcggttggaatgaacgggtcggcaaatatcgggaaaaatgccgccatgttcgaggccatc
cacggttccgcaccggatattgccgggagaaagcttgccaatccttcaggtctgatcaat
gcggcggtcatgatgctggttcacatcggcatgcccgataccggacgcagaatcgaaaat
gcctggctgaaaaccatcgaggacggcattcataccgcagaaatttactcagacgggcac
agcacccaccttgcgaacaccgatgagttcgcagatgcggtaattgatcggcttggcagc
aatcctggctttttccacggagcagagttcagctccgatatgcccgccatcaaaattcca
gattatcagcgcccggatgtaaaaaaggtgctggcgggggtggatgtgtttatcgaccac
ggaagcatcagccccgatgagctgggaaacaccctgagcgacatcgccggcgccgccaga
agcagtctgcttcttaaggtgatcaccaaccggggagtaaaggtgtacccccagggattt
ccggaaacattcaccaccgaccactggagatgcaggtttcttatggaaaagccgccggtg
tctacagatatggagggccttgagccggaatcggtgattgagattcagcagctgatcatg
ggcgccgggttggagatcatcaaaaccgaaaatctgtactattttgacggagaaccaggc
tacagtctggctcagggggaataa

KEGG   Salinispira pacifica: L21SP2_2407Help
Entry
L21SP2_2407       CDS       T03013                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slr  Salinispira pacifica
Pathway
slr00020  Citrate cycle (TCA cycle)
slr00480  Glutathione metabolism
slr01100  Metabolic pathways
slr01110  Biosynthesis of secondary metabolites
slr01120  Microbial metabolism in diverse environments
slr01130  Biosynthesis of antibiotics
slr01200  Carbon metabolism
slr01210  2-Oxocarboxylic acid metabolism
slr01230  Biosynthesis of amino acids
Module
slr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L21SP2_2407
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L21SP2_2407
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     L21SP2_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CAMP_factor
Motif
Other DBs
NCBI-ProteinID: AHC15760
UniProt: V5WJE7
Position
complement(2577242..2579461)
Genome map
AA seq 739 aa AA seqDB search
MSKIIYTRTDEAPALATYSLLPVIQQFAGTAGVDIETRDISLAARILSQFPDYLSTEQKV
HDALAELGELVQRPEANIIKLPNISASIPQIKRAVSELQAAGFAVPDYPDEPQSDTEREI
RKRYDRVKGSAVNPVLREGNSDRRAPRAVKNYAKKHPHSMGEWTPESRSVVASMSEGDFY
GSEESVRFQQADSVQIEFHGNDGSRKTLKPWFPMEKGEILDAARMSRKALRDFLKKEIRD
AKEAGVLFSIHLKATMMKVSDPIIFGHGVSVFFEDVFSRYGEDLHKAGVNPNNGLGDLLA
RLDQLPESKRQEILDSIENALDQGPELAMVDSDNGITNLHVPSDVIIDASMPAAIRAGGK
MWAPDGSQKDMKAVIPDRSYAGVYAETIEHCKKHGAFDPRTMGSVSNVGLMAQKAEEYGS
HDKTFEIPESGNVVVRRESDEAEIFRYDVEEGDIFRMCQVKEAAVSDWVKLAVNRGRESG
VPVVFWLDGRRAHDSQLIKRVENLLPHHDTDGLEIYIMPPVEAARYSLDVARAGKDCIAV
TGNVLRDYLTDLFPILELGTSAKMLSIVPLMNDGGLFETGAGGSAPKHVQQFVKEGHLRW
DSLGEFLALGMSLKHLGRSFDNPRAIVLGDALDAATEKLLDNNKSPRRKVHELDNRGSHY
YLAMYWAEALAENNDDPELARRASELARKLEKHEQDILRELDDAQGAPVEIGGYFYPEQK
LASRAMRPSETFNRILAEF
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattatctatacacgtaccgatgaagctccggctctggcaacatattccctt
cttcccgtcattcagcagtttgccgggactgcgggagttgatattgaaacccgggatatt
tcccttgcagcccggattctttcccagtttccggattacctttctaccgagcagaaggtg
catgatgctctggccgagctgggagaactggtgcagcggcccgaggcgaatattatcaaa
cttccaaatatcagcgcttccatcccccagattaaacgggcggtttcagaacttcaggca
gccgggtttgccgtaccggactatcccgatgagccccaatccgatacggaacgggaaatc
cgtaagcgctacgacagggtgaaaggatccgccgtgaatcccgtgcttcgggaaggaaat
tccgaccgaagagcaccccgggcggtgaaaaattatgcaaaaaagcatccccacagcatg
ggagaatggactccggaatccaggtccgtagttgcaagcatgagcgaaggggatttctac
ggaagcgaggaatctgtacggtttcagcaggctgattcggtgcagattgagtttcatggc
aacgacggcagccgaaaaaccctgaaaccctggtttcccatggagaagggggagattctc
gacgcggcccggatgagccggaaggctctgagagattttctgaaaaaagagatacgggac
gcaaaagaggcgggagtgctgttttccatccatctgaaggcaaccatgatgaaggtatcg
gacccgattattttcggtcatggggtttccgtcttctttgaggatgttttttcccggtac
ggggaggatttacacaaagcgggagtgaaccccaataacggactgggggatcttctcgcc
aggctggatcagctgcccgaatccaaacggcaggaaattctcgactccatcgaaaatgcc
cttgaccagggtccggaactggccatggtggattcggataacggaatcaccaatcttcat
gtacccagcgatgtgattatcgacgcttcaatgccggcggccatccgggccggggggaag
atgtgggctccagacggcagccagaaagatatgaaggcggtgatccccgacagaagctat
gcgggagtgtacgcagaaacgattgaacactgtaaaaagcatggtgcgttcgatccccga
accatggggagcgtatccaatgtggggctgatggcacaaaaggccgaggaatacggttcc
cacgataaaacctttgaaattcccgaatccgggaacgtggttgtccgccgtgagtcggat
gaagcggaaatcttccggtatgatgttgaagagggtgatattttccggatgtgccaggtg
aaggaagccgcagtcagcgactgggtgaaactggctgtgaacaggggacgggagtcggga
gtacccgtggtgttctggcttgacggccggcgggcccacgacagtcagctgatcaaaagg
gttgagaacctgctcccccaccacgacaccgatggactggagatctatattatgcctccg
gttgaggccgcccgctattccctggatgttgcccgggccggaaaagactgtatagccgtt
acaggaaatgtgctcagagactatctcaccgacctgttccccattctcgaacttggaacc
agcgccaagatgctttcaatcgttcccctgatgaatgacggaggactttttgaaaccgga
gccggggggtcggcacccaagcatgtacagcagtttgtgaaagaagggcatctgcgctgg
gattctctgggggaatttctggccctggggatgagcctgaagcatctgggacgttcattt
gataacccccgggcaattgttctgggtgatgccctggacgcggccacggaaaagctgctg
gacaataacaagagtcccaggcggaaagttcatgaactggacaatcgggggagtcactac
tatctggccatgtactgggcggaagctcttgcggaaaataacgacgatcccgaacttgcc
cgcagggcctcagagctggcccggaagctggagaaacatgaacaggatattctccgcgaa
ctggatgacgcccagggtgccccggttgaaatcggaggctatttttacccggagcaaaag
ctggcgtcccgggccatgcggcccagcgaaaccttcaaccgcattcttgcggaattctaa

DBGET integrated database retrieval system