KEGG   Salinispira pacifica: L21SP2_1009Help
Entry
L21SP2_1009       CDS       T03013                                 

Definition
(GenBank) Alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
slr  Salinispira pacifica
Pathway
slr00250  Alanine, aspartate and glutamate metabolism
slr00430  Taurine and hypotaurine metabolism
slr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L21SP2_1009
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    L21SP2_1009
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     L21SP2_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C 3HCDH_N Shikimate_DH Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N ADH_zinc_N NAD_binding_2 F420_oxidored NAD_binding_7 Gp_dh_N TrkA_N AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AHC14427
UniProt: V5WF51
Position
complement(1077111..1078223)
Genome map
AA seq 370 aa AA seqDB search
MVVGTVREIKRHEYRIGLTPQCVQAYIGRGHSVLVEKDAGLGAGFTNEEYLEAGAQLIDG
AAEVFKAADMIVKVKEPQPVEIEMLRKDQILYTYLHLAADEAQTRGLMKKGVKAIAYETI
EPQKGLLPCLKPMSEIAGRLSAQEGAKYLEKPFGGRGVLLGGVPGVARGKVAILGGGVVG
TNAAQIAMGMGAEVTILDINAGRLEELDQLYHGQLSTLYSTQANIDKVLEESDLIIGAVL
IPGAKAPRLIRREDLSKMKTGALLVDVAIDQGGCFETSKPTTHDDPVYTVDGIQHYCVAN
MPGAVSRTSTLALTSTTLSYGLAIAGKGVEKACKEDNALKLGLNLYNGKITYKGVADAFD
LEYTDPDSIL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaggaacagtgcgggagattaaacggcatgaataccggatcgggctcaccccc
caatgcgtacaggcatacatcgggagaggtcattcggttctggttgaaaaggacgcaggt
cttggagcgggattcaccaatgaagagtatctggaagcgggagcacagctgatcgacggt
gccgcagaagtgttcaaagctgcggacatgattgtgaaggtgaaagagccacagcccgtc
gagatagaaatgctccgcaaggatcagattctctacacatatctgcatcttgcagccgac
gaagcccagaccaggggactgatgaagaagggggtaaaagccattgcctacgaaaccatt
gaacctcagaagggtctgcttccctgtctcaaacccatgagcgagattgccggccggctc
agtgcccaggagggagccaagtatctggaaaaacccttcggcggccggggagtgctgctg
ggcggtgttccgggagttgcacggggcaaagtggccatcctgggaggaggggttgttgga
accaatgccgcccagattgccatgggaatgggagcagaggtaaccattctggatatcaac
gccggcagacttgaagagctggatcagctgtatcacggtcagctgagcaccctctactcc
acccaggccaatatcgataaggttctggaagaaagcgatctgattatcggcgcagtgctg
attccgggagcaaaggccccccgtctgatccgccgggaggatctttcgaaaatgaaaacc
ggcgccctgctggtggatgtagccatcgaccagggaggatgcttcgaaacatccaagccc
accacccacgacgatccggtgtataccgtggacggcattcagcattactgcgtggccaac
atgcccggggcggtttcccggacatccacccttgccctcaccagcaccaccctctcctac
ggcttggcaatcgccgggaagggtgtggaaaaagcctgcaaggaagacaatgcgctgaag
ctggggctgaatctctataacggaaaaatcacctacaagggtgtggcggacgcattcgat
ctggaatacactgatccggacagcatcctgtga

DBGET integrated database retrieval system