KEGG   Salinispira pacifica: L21SP2_1021
Entry
L21SP2_1021       CDS       T03013                                 

Definition
(GenBank) D-Ornithine 4,5-aminomutase E subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
slr  Salinispira pacifica
Pathway
slr00472  D-Arginine and D-ornithine metabolism
slr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    L21SP2_1021
Enzymes [BR:slr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     L21SP2_1021
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AHC14439
UniProt: V5WFU4
Position
complement(1097105..1099354)
AA seq 749 aa
MDMNTENPNKTGKSAHMQLNPNEKLDVERILEDLEHYHPRRRGWFWRKGGGQKRQIGPFE
YYQTTENLSHSVPLPAAHYFGDIDPQPVSTITTEIASGRFEDDIRRMRMAAWHGADHLMV
IRTAGQSHMDGLLEGSPQGIGGVAITRKQLRAQRKALDLIEDEVGRPINYHSYVSGVAGP
EMAVLFAEEGVNGAHQDPQYNVLYRNVNMVRSFVDAAVAKRVMAWAGIAQIDGAHNANAT
ARQAWKVMPELMVQHALNSMFSVKAGMKPEDICLSTVPPSAPPAPAMRLDLPYAVALREL
FRDYKMRAQQNTKYMTSSAREATVTHTLNLLISQFTRAEIQSTITPDEGRNVPWHIYNVE
GTDTAKQAFNGMDGLMEMVSLRRDEGELAENVRELKERAVLYMEEMLELGGYFDAVEAGM
FVDSGKYPERNGDPIVRKRDGGVGAGTVYPRDDDYMAPVTAHFGYNNLAPYGTEAEKNPS
SLIDGCTFEKPEKIVFIDELDENDNVAVRMAETAHLRNSSIIKPEMEWQGDGTVLLTMFL
PTDQRTARFAALEAAKNMNLSEAEVIHAEVMHPAEGTRIELKGKVAFTIDTSKLEIPPEP
KVLSEEEIRAEIKARPMAIVAGTVGEDEHSVGLREIIDIKHGGIEGYGIECHYLGTSVPV
EKLVDAAIEINAQAILVSTIISHDEIHYKNMKRVHDLAVEKGVRDNILIIAGGTQVTPDL
AVKQGVDAGFGRGTKGIHVATFLVENRKS
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggacatgaacaccgaaaaccccaataaaacagggaaatcagctcacatgcagctgaat
cccaatgaaaaactggatgtggaacggatcctggaggatcttgagcattatcatccccgg
aggcggggctggttctggcgcaaaggcggcggacagaagcggcagatcggccccttcgag
tattatcagaccaccgaaaacctttcccattccgtccccctccccgccgcccactacttc
ggcgatattgatccccagccggtgagcactatcaccaccgagatcgcctccggccgcttt
gaggacgatattcggcggatgcggatggcagcctggcacggagccgatcatctgatggtg
atccgcaccgccgggcagagtcatatggacggtcttctggaaggcagcccccaggggatc
ggcggggttgccattaccaggaagcagctgagggcccagagaaaggccctggatctcata
gaagatgaggtggggcggcccataaactaccattcctacgtgagcggcgtggccggaccc
gagatggcggttctcttcgctgaagaaggggtgaacggcgcccaccaggatccccagtac
aacgtgctgtaccggaacgtgaatatggtgcgctcctttgtggatgctgcggttgccaag
agggtaatggcatgggcggggatcgcccagattgacggcgcccataatgccaacgccacc
gcccggcaggcctggaaggtaatgcccgagctgatggttcagcacgcactgaactccatg
ttctccgtgaaagcgggaatgaagcccgaggatatttgcctctcaacagtaccccccagc
gcacctcccgctccggccatgcggctggatctgccctatgccgtggctctgagagaactg
ttccgggattacaagatgcgggcccagcagaacaccaagtacatgacgtcatcggccagg
gaggccacggtcacccataccctgaacctcctgatcagtcagttcacccgggctgaaatc
cagtccaccatcacccccgacgaagggcggaatgttccctggcatatttacaacgtggag
ggcaccgataccgccaagcaggcgttcaacggcatggacggcctgatggagatggtctcc
ctgcggcgggacgaaggggaactggctgagaatgtccgggaactgaaggagcgggcggtt
ctctacatggaagagatgctggagctggggggatatttcgatgcggtggaagcgggaatg
tttgtggactcgggaaagtacccggagcgcaacggggatcccattgtacgcaaacgtgac
gggggcgtgggtgcgggaaccgtatatccccgggacgatgattacatggctccggtgacc
gcgcatttcggttacaacaatcttgccccctacggaacagaggccgagaaaaacccctcc
agtctcattgacggctgcaccttcgaaaagcccgagaaaattgtgtttattgatgagctg
gatgaaaacgataatgtggcggtccggatggccgaaaccgcccatttacgcaactcatcc
atcatcaaaccggagatggaatggcagggggacggcacggtgcttctcaccatgtttctg
cccaccgaccagcggaccgcccgctttgcggccctggaggctgcaaagaacatgaacctt
tccgaagccgaggtgattcacgcggaggtgatgcatccggcggaaggaacccgcattgaa
ctgaaggggaaggttgccttcaccatcgatacctccaaactggaaattcccccggagccc
aaggtactcagcgaagaggagatcagggcagagatcaaggcccggcccatggccatcgtg
gctggtacggtgggcgaggacgagcattcggtgggcctgcgggagatcatcgatatcaaa
cacggcggaattgagggctacggaattgaatgccactatctgggaaccagcgtacctgtt
gaaaagctggtggatgcggcaattgagatcaacgcccaggccatcctggtttccacgatt
atcagccatgacgaaattcattacaaaaatatgaaacgggtccatgatctggcggttgag
aaaggcgtgcgcgataacattctgattatcgcaggcggcacccaggtgacccccgacctt
gcggtgaagcagggcgtggatgcgggattcggccggggaaccaagggaatacacgtggcc
accttcctggtggaaaacaggaagagctga

DBGET integrated database retrieval system