KEGG   Salinispira pacifica: L21SP2_1022
Entry
L21SP2_1022       CDS       T03013                                 

Definition
(GenBank) D-Ornithine 4,5-aminomutase S subunit
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
slr  Salinispira pacifica
Pathway
slr00472  D-Arginine and D-ornithine metabolism
slr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    L21SP2_1022
Enzymes [BR:slr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     L21SP2_1022
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A HrpE
Other DBs
NCBI-ProteinID: AHC14440
UniProt: V5WFM7
Position
complement(1099345..1099701)
AA seq 118 aa
MQERKDDFQVRRKHLADLSEKQLEERFWQLADALTQPLIDTAYHHTSPSIERSVLLRMGI
SSLEAAAIVEKALDHELLGKGAGHIVYRIAADQGISIGEAAAALAEGKFWKEARAIWT
NT seq 357 nt   +upstreamnt  +downstreamnt
atgcaggagcgaaaggatgattttcaggtcaggagaaaacatctggcagatttgagcgaa
aaacagctggaggaacggttctggcagctcgccgacgccctcacccagccgctgatagat
acggcctaccatcacaccagcccctccattgaacggtcggtgctgctgcggatgggaatt
tccagccttgaggcggcggcaattgtggaaaaagccctggaccacgaacttctgggcaaa
ggcgcagggcatatcgtgtaccgcatcgcagcagatcagggcatctcaatcggcgaagct
gcggcggccctggccgaaggaaaattctggaaggaggcccgggccatatggacatga

DBGET integrated database retrieval system