KEGG   Salinispira pacifica: L21SP2_1127Help
Entry
L21SP2_1127       CDS       T03013                                 

Definition
(GenBank) Phosphate acetyltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
slr  Salinispira pacifica
Pathway
slr00430  Taurine and hypotaurine metabolism
slr00620  Pyruvate metabolism
slr00640  Propanoate metabolism
slr00680  Methane metabolism
slr01100  Metabolic pathways
slr01120  Microbial metabolism in diverse environments
slr01200  Carbon metabolism
Module
slr_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    L21SP2_1127
   00640 Propanoate metabolism
    L21SP2_1127
  09102 Energy metabolism
   00680 Methane metabolism
    L21SP2_1127
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    L21SP2_1127
Enzymes [BR:slr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     L21SP2_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB MHB
Motif
Other DBs
NCBI-ProteinID: AHC14530
UniProt: V5WFZ9
Position
complement(1202891..1203886)
Genome map
AA seq 331 aa AA seqDB search
MTFIENMHHIAKQKQKHLVLPEGTEPRTIQAAAEIRKRGIAAKVSLLGDKDAIAQKAKEL
SVDLSQVDIITPASDERRNAYGSEYYELRKHKGMTSDQAYADMDHVLRFGCMMVRLGDAD
AVVAGAENTTGDVLKAAFTIIKTKPGISSASSCFVMIHPDTQWGHEGQMIFSDCATIPNP
SDAQLAEIAAAAAESCRTFLKTEPRVAMLSFSTKGSAKTEETEKVVRATQMVKEAHPDLE
IDGELQLDAAIVPSVGKKKAPGSAVAGHANTLIFPDLQAGNIGYKLVQRLGGAEAIGPVL
QGFAKPISDLSRGCSVEDIVNTGALTISQCE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacatttatcgaaaacatgcatcacattgccaaacaaaaacaaaaacatctggttctt
ccggaaggaacagaacccagaaccattcaggcagcggcagaaatccggaagcggggaatc
gccgcaaaggtgagcctgctgggtgacaaagatgcgattgcacaaaaggcgaaggaatta
tccgtggatctttcccaggttgatatcatcacacctgcctccgatgagcggagaaacgcg
tacggcagcgaatattatgagttgagaaagcataaggggatgacctccgatcaggcctat
gccgatatggatcatgtactccgcttcggctgcatgatggtgcgtctgggcgatgccgat
gcggtggtcgccggtgcggaaaataccaccggagatgttctgaaggcggcgttcaccatt
atcaagaccaaaccgggaatcagttccgcatcatcctgctttgtgatgatccacccggac
acccagtgggggcatgagggacagatgatcttcagcgattgtgcgaccattcccaacccc
agcgatgcccagcttgcagaaattgccgcagcggctgcagaaagctgccgcacattcctg
aagactgaacccagggtagccatgctcagcttctcaaccaagggcagtgcgaagactgaa
gagacagaaaaggtagtccgggccacccaaatggttaaggaagcccatccggatctggaa
atagacggcgaactgcaactggatgcggccattgtgccctctgtggggaagaaaaaagcc
ccggggtcagctgtagccggacacgccaacaccctgatcttcccggatctgcaggccggg
aacatcgggtacaagctggtacagcgcctgggaggagccgaagcaatcggtccggtgctc
cagggattcgccaagcccatcagcgacctcagccggggctgctctgtggaggacatcgtg
aacaccggagcgctgacaatcagccagtgcgagtaa

DBGET integrated database retrieval system