KEGG   Salinispira pacifica: L21SP2_1397Help
Entry
L21SP2_1397       CDS       T03013                                 

Definition
(GenBank) Glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
slr  Salinispira pacifica
Pathway
slr00860  Porphyrin and chlorophyll metabolism
slr00970  Aminoacyl-tRNA biosynthesis
slr01100  Metabolic pathways
slr01110  Biosynthesis of secondary metabolites
slr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L21SP2_1397
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    L21SP2_1397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slr01007]
    L21SP2_1397
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slr03016]
    L21SP2_1397
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:slr02048]
    L21SP2_1397
Enzymes [BR:slr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     L21SP2_1397
Amino acid related enzymes [BR:slr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   L21SP2_1397
Transfer RNA biogenesis [BR:slr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    L21SP2_1397
 Prokaryotic Type
   Other AARSs
    L21SP2_1397
Prokaryotic defense system [BR:slr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    L21SP2_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c RuvB_C
Motif
Other DBs
NCBI-ProteinID: AHC14796
UniProt: V5WI00
Position
1479930..1481405
Genome map
AA seq 491 aa AA seqDB search
MSVRVRYAPSPTGLQHIGSLRTALFNYFFARSQGGTFILRVEDTDQTRFDPRALQDIYDT
FDWIGIHWDEGPDVGGEYGPYIQSERFDLYKEHALRLVEEGKAYKCFCSAERLEKLREEQ
SKQKGGHQGYDRHCRNLSSTDVASKEAAGEPYVIRFKIPLEGETVISDRVLGETRRKHKD
INPDPVLLKTDGFPTYHLANVVDDHHMGITHILRAQEWVSSAALHVLLYKAFGWEVPEFV
HLPMVMGKDGSKLSKRHGSTSVIDFRNQGYLPEALVNYVTMVGWGYDESTEFFSIQDLER
VFSDGKINKAPGVFDYKKLQWYNSQYIARTDENRLVDLCLPYLVDEGFITRDARGDVPSD
QLELLQSVMPLAKERMKLLSDIPSVAGFLFRDFTLNGAGDLVQKKQNPEDTKKILEQIRD
DFTTIADLDEEGFHDYFQNLAESLETGMGKVMMPLRIAITGSRATPPMADSIRLMGREKA
LSRLETAIGLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccgcgtccgctatgccccgagtccaacggggttacagcacatagggagtctt
cgaacggctctcttcaactactttttcgcccgcagccagggcggaactttcattttacgg
gtggaagacaccgaccagacccggtttgatccccgggcccttcaggatatttacgatacc
tttgactggatcgggatccactgggacgagggtcccgatgtggggggcgaatacggcccc
tacatccagagtgaacgttttgacctctataaagagcatgccctccgccttgtggaagag
ggcaaggcctacaaatgcttctgcagcgctgagcgtctggaaaagctgagggaagagcag
agcaaacagaaaggcggacaccagggctacgaccgccactgccggaatctcagcagcacg
gatgttgcatccaaagaagccgccggagaaccttatgtgatccgtttcaagattcctctg
gagggagaaacggtaatttccgaccgggttctgggggaaaccagaagaaagcacaaggac
atcaatcccgacccggtattgctgaaaaccgacggattccccacataccatctggccaat
gtggtggacgaccatcacatgggaattacccatattctccgggcacaggaatgggtgagt
tcagcggcccttcatgttctgctgtacaaggccttcggttgggaggttccggaatttgtc
cacctgcccatggtaatgggaaaggacggatccaagctttcgaaacgccacggatcaaca
tcagtgatcgacttccgaaaccagggatatcttcccgaggcactggtgaattatgtgacc
atggtgggctggggttatgacgaatccacagagtttttcagcattcaggatctggagcgg
gtcttcagtgacggtaaaatcaataaggctccaggagtttttgattacaaaaaacttcag
tggtacaactcccagtatattgcccgtaccgatgagaaccggcttgtggatctctgcctt
ccctatcttgtagatgaaggttttataaccagggacgcccgcggcgatgttccctctgat
cagcttgaactgcttcagagcgtgatgcctctggcaaaagagcggatgaagcttttgtcg
gatattccgtcggtggcaggattcctgttccgggattttaccctcaacggagcgggagat
ctggtgcagaagaagcagaacccggaagatacgaaaaaaatcctggaacaaatccgggat
gatttcaccacaattgcagacctggatgaagaaggattccacgactatttccagaatctt
gcggaatccctggagacaggtatggggaaggtgatgatgcctctgcgaatcgcaatcacc
ggaagccgtgcaactcctcctatggcggattctatccgtctcatgggccgggaaaaggcc
ctgtcccggctggaaacggcaatcgggctgctgtaa

DBGET integrated database retrieval system