KEGG   Salinispira pacifica: L21SP2_2587Help
Entry
L21SP2_2587       CDS       T03013                                 

Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
slr  Salinispira pacifica
Pathway
slr00430  Taurine and hypotaurine metabolism
slr00460  Cyanoamino acid metabolism
slr00480  Glutathione metabolism
slr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    L21SP2_2587
   00460 Cyanoamino acid metabolism
    L21SP2_2587
   00480 Glutathione metabolism
    L21SP2_2587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slr01002]
    L21SP2_2587
Enzymes [BR:slr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     L21SP2_2587
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     L21SP2_2587
Peptidases and inhibitors [BR:slr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   L21SP2_2587
CD molecules [BR:slr04090]
 Proteins
  L21SP2_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AHC15939
UniProt: V5WK22
Position
complement(2767636..2769264)
Genome map
AA seq 542 aa AA seqDB search
MNYDPHYNPFFSKRNPVYARRGMVATSHPAAADIGLDILKQGGNAVDAAVAAAAALAVLE
PTSNGLGSDCFAIIHDGSRLHGLNASGWSPAALSADVLLNAGRKEISPFGWDAVTVPGAM
AGWHELTEKFGSLSPAELLQPLVSRFSPGTDGEGGVAVPPTVAANWERALNAYSKHLPDD
PAFRHWFEHFAPRGKAPSAGEAWSSRDQLKTLEILGKEGFRSLYDGSLADALLQFSGESG
GYLQREDLMDYRPTWVDPISMSYKGYDIWEIPPNGQGITALMALGMLKDDRFSAHGVPSD
MHRGIEAIKLAFSDTTRYVTDPGHMAHTAGNLLDPEYLAGRRSMIGESAGDPAPGTPPRG
GTVYLSAADSSGMMVSFIQSNYMGFGSGLVVPGLGIALQNRGHNFTLEEGHPNRLEGRKR
PFHTIIPGFLTREGRALGPFGVMGGFMQPQGHLQVVQNLIDYGLNPQAALDAPRWQWMQG
RRVMLEPGFGQEGCNALKRLGHDAVLESDSGHFGRGQMILREEGGGFIGATEKRCDGFIA
SW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgatccccactataacccatttttctcaaaacggaaccccgtatatgcccgc
cggggcatggttgcaacttcccatcccgctgcggcggatatcgggctggatattctcaaa
cagggcggtaatgccgtggatgccgcggttgccgcggcggcggccctggcggtgctcgaa
cccacatccaacggtctggggtcggactgctttgccattatacacgacggcagcaggctg
catggtctgaatgccagcggctggagccccgcggctctgagcgcggacgtactgctgaat
gcggggcggaaagaaatttctcccttcggctgggatgcggttaccgttcccggtgccatg
gccggctggcacgaactcactgaaaaattcggaagcctcagcccggctgagctgcttcag
ccccttgtatccaggttttccccgggaacggacggagagggcggcgttgccgtgccccct
acggttgcggcaaactgggaacgggccctgaacgcctactcgaaacatctccccgatgat
cctgccttccgtcactggtttgaacacttcgctccccggggaaaagcaccttccgccgga
gaagcctggagcagccgggaccagctgaagaccctggaaatccttggaaaagaagggttc
cgctccctttacgacggcagcctggctgatgcactgctgcagttcagcggagaaagcgga
ggatacttacagagggaagatctcatggattaccgacccacctgggtggaccccatttcc
atgagctacaagggctatgatatctgggaaattccacccaacggacaggggatcaccgcc
cttatggccctggggatgctcaaggatgaccgtttttccgcccacggggtaccttccgac
atgcaccggggcatagaggccattaagcttgccttttcggataccacccgctacgtgacc
gatcccggccatatggcccacaccgccggaaacctgctggatcccgagtatcttgccggc
cgccggtccatgattggagagtcggcgggggatcctgctccgggcacgcccccccggggg
ggaaccgtctatctttcggcggcggacagttcgggaatgatggtgagttttattcaaagc
aattacatggggttcggaagcggcctggtggtgccgggcctaggtattgcacttcagaac
cgggggcataattttacccttgaagagggacatcccaaccgactggaaggccggaagcgc
ccatttcacaccatcattcccggtttccttacccgggaggggcgtgccctggggcccttc
ggggtaatggggggcttcatgcagccccagggacatctgcaggtggtgcagaatctcata
gattacggcttgaacccccaggcggctctggacgccccccggtggcagtggatgcagggg
agaagggtgatgcttgagcccgggttcgggcaggagggctgtaatgccctgaagcgcctg
gggcatgatgcggtgctggaatccgattccgggcatttcggacggggccagatgattctc
cgggaagagggtggcggcttcatcggcgcaacagaaaagaggtgtgacgggtttattgca
tcctggtaa

DBGET integrated database retrieval system