KEGG   Salinispira pacifica: L21SP2_2804Help
Entry
L21SP2_2804       CDS       T03013                                 

Definition
(GenBank) Pyruvate carboxyl transferase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
slr  Salinispira pacifica
Pathway
slr00020  Citrate cycle (TCA cycle)
slr00620  Pyruvate metabolism
slr01100  Metabolic pathways
slr01120  Microbial metabolism in diverse environments
slr01200  Carbon metabolism
slr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L21SP2_2804
   00620 Pyruvate metabolism
    L21SP2_2804
Enzymes [BR:slr01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     L21SP2_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA Biotin_lipoyl HMGL-like Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AHC16154
UniProt: V5WKT5
Position
complement(3024073..3025965)
Genome map
AA seq 630 aa AA seqDB search
MKKIDVMITAFRDGFQSAYGARVLTDDFLPAVEATREAGITHFEAGGGARFQALYFYCNE
DAFTMMDRFREAAGPDANLQTLSRGVNVVGLDSQPSDIIEMHARLFKKHGITTIRNFDAL
NDVNNLIPSGSYIHKAGLRHEVAVTLMSLPPGTPGADTAHTPEFYTATLQRILDSGVPFD
SVCYKDASGTSTPRTVYESIREARKILPPEIPLRFHSHDTLGTCIPQYQAAIEAGATGID
LSMAPVSGGTCQSDVISMWHVLRGSEFDLGIDIEKMREAEEVFKDCMKDYFVPPESKTIE
PLIPFSPMPGGALTANTQMLRDNDMLDSYPKIIEKMREVVKLGGFGTSVTPVSQFYFQQA
FNNAIFGDWKKIAQGYGKMVLGYFGKTPFPPDPDVVAEASKQLGLEPTTKTVLELNDADP
SKGRKPAVLMLSEAGIEETEENIFIAATCREKGIQYLKGEAVLGIRKKAGESGESRPAAH
PETPGQPGGGDGLQQLRVQVDGQEFLVNFLPDGSAEVDGQKFRMQIDEESGNDRSATVSA
SGSGEKRQPEGGKTVALDAPLAGTIVSIAKSPGQQVAAGETICVLEAMKMENEVKAPETG
VLESLSVARGQKVASGTRLAEIRCSGISRG
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagatgtaatgatcactgccttcagggacgggttccaatccgcttatggg
gcgcgggtgcttacggatgattttcttccggcggttgaagccaccagggaggcgggaata
acccattttgaagccggtggaggagcccgatttcaggcactctatttctactgcaatgaa
gatgcattcaccatgatggatcggttccgggaagctgctgggcctgatgcaaatcttcaa
accctttcccggggggttaatgtggtgggactggattcccagcccagcgatatcatagaa
atgcatgcccggctgttcaaaaaacacggtatcacgaccatcaggaattttgatgccttg
aatgatgtgaataaccttattccttcaggcagctatattcacaaagccggactgcggcat
gaagtggcagttactcttatgagcctgcctcctggaacccccggtgcggataccgcacac
actccggaattttataccgccacattgcagaggattcttgattcgggtgttcctttcgat
tcggtctgctacaaggatgcctcgggaacatcaaccccccggacggtctatgagtccatc
cgtgaagcccgcaagattcttcccccggaaattcccctccgctttcacagtcacgatacc
ctgggaacctgtattccccagtatcaggcggccattgaggccggagccacggggatcgat
ctatccatggcccctgtctccggaggaacctgccagagcgatgtaatctccatgtggcat
gtgctgcggggaagtgaatttgatctgggtatcgacattgagaaaatgcgggaagcggag
gaggtattcaaggattgcatgaaggattacttcgtacccccggaatccaaaaccattgaa
ccattgatcccgttttcacccatgcccggaggagcgctcaccgccaacacccagatgctc
agggacaacgatatgttggattcatatccgaagatcatcgaaaagatgcgggaggtggtg
aagctgggaggcttcggcacctcggtgactccggtgtcccagttctatttccagcaggcc
tttaacaatgccatcttcggcgactggaaaaagattgcccaaggatatggaaagatggtg
ctcggctatttcggaaaaactccctttcccccggacccggatgtggttgccgaggcttcg
aagcagctcggactggaacccacaaccaaaactgtgctggagctgaacgatgcggatcct
tcaaaggggcgaaagccggcggttctgatgctcagcgaagcgggaatcgaggaaacagaa
gaaaatatttttatcgctgcaacctgcagggaaaaaggcatacagtatctgaaaggggag
gcggtcctgggaatccgcaaaaaggcaggggagtccggcgaaagccgccctgcagctcac
ccagaaacgcccgggcaacccggcggaggcgacgggcttcagcagctgcgggtgcaggtt
gacgggcaggaattcctggtgaactttctccccgatggatctgcagaggtggacggtcag
aaattcaggatgcagatagacgaagagtcaggaaacgatcggagtgcgacggtttctgct
tccggctccggggagaagcggcagccggaagggggaaagacggttgcactggacgccccc
ttggcgggtaccattgtaagcatagccaagtctccggggcagcaggttgccgccggggag
acaatctgtgtgctggaagccatgaaaatggaaaacgaggtgaaagccccggaaaccggt
gtgctggaatcattgagcgtagcccggggtcagaaagttgcttcgggaacccgcttggcg
gagattcgctgcagcggcatctccagggggtaa

DBGET integrated database retrieval system