KEGG   Salinispira pacifica: L21SP2_2960Help
Entry
L21SP2_2960       CDS       T03013                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
slr  Salinispira pacifica
Pathway
slr00900  Terpenoid backbone biosynthesis
slr01110  Biosynthesis of secondary metabolites
slr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L21SP2_2960
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     L21SP2_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red FMN_dh
Motif
Other DBs
NCBI-ProteinID: AHC16306
UniProt: V5WMC7
Position
3188347..3190968
Genome map
AA seq 873 aa AA seqDB search
MNNQTHKHHSEISSDQHSGDSAEQMGSRKAAHINICTDETYPVEGGNSAFSGVKFIHSSL
PELDYDQIDSSCDFLGFRLSAPVMISCMTGGSDQGYRLNKILAEAAQKKKVAVGTGSLRI
LLRKPEVIDHFRLKEMAPDVPVIGNIGAVQLPEMMADDKALLRQFYDILRELKLDALAVH
LNPGQELFQEGGDRNFRNILASIRELCAWSELPVIVKETGAGIPPAEAAALFASGVRYVD
IAGSGGTNWLSVEAFREEHDRRLQGRDHQPIPRELHGFEDWGIPSAPGLSALSSYCRKRG
LVPSNGGIISSGGLRDPMDYPRALALGGDLAAAALPFIRLARSGGAAAVESYLDEIFLTL
RRTMLLTGSATIHELKQAPLLIDPDFSRYSEQLLQTARQSAGTHRGQQPHISREKTPPEP
PPETSPETSPETSPETSPERSPALNDRKFRKYNIHRRRRMLANDPVLNLDREAVNAGGHS
DSMLDLADVMVESAVGFMPVPMGIAKGFLIDGRLHHLPLSVEEPSVIAAASYAAGIIARN
GGFETSADEPLMSAYIYLDISSRSGDPSPEAIRSALKSVKDEEQRLKDLLSPVLESMTRR
GGGYRSMEASWLEESRTLRVELTLDVRDAMGANILNTAAETISPLLEEITGGEKLMAILS
NDAVKRRAKARFAIPFTALSRGKYSGRELAERIVKLYEIADEDPSRAVTHNKGIMNGISS
LALATANDTRATEAAAHAWAARSGRYRSLSVFRIEGDRLVGELELPLALGTVGGGISFHP
AARFALDILGKPDAPALSRMAAALGLAQNFAAISALAGEGIQKGHMKLHSGRLAYKAGAR
GDSIPLLVEKIQQSGVYNMEQARRLLEEIGRNR
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcaaacccataaacaccattccgagatttcttcggatcagcactccggagat
tcagcggagcagatgggcagccggaaggctgcccatattaatatctgcacagacgaaacg
tatcccgtagagggaggaaacagcgctttttccggggtgaagttcattcacagcagtctg
ccggagctggactacgaccaaatcgacagcagctgtgatttcctcggcttccgcttgtcg
gctccggtgatgatatcctgcatgaccggaggctcggaccagggatacagactgaacaaa
attcttgcagaggccgcccagaagaaaaaggtggcggttggaaccggcagccttcgaatt
cttctgcgaaaacctgaagtgatcgatcacttcaggctgaaggaaatggctccggatgtt
ccggtaatcggaaacatcggggcggttcagctgccggaaatgatggccgacgataaggct
ctgctcaggcaattctacgatattctcagagagctgaagctggatgccctggccgttcac
ctgaatcccggacaggaactgttccaggaggggggagacaggaatttccggaacatcctg
gcaagcattcgggagctgtgtgcgtggagcgagcttcccgttattgtcaaggaaaccgga
gcgggcattccccctgccgaggccgcagccctgtttgcctcgggggtgcgctatgttgat
attgccggatccgggggaaccaactggctttcggtggaagccttcagggaagaacatgac
agacggctccagggcagggatcatcagcccattccccgggagcttcacggctttgaagat
tggggaatcccttcggcccccggtctgtcggccctgagcagctactgcagaaaacgggga
ctggtaccctccaacggaggcatcatatcatcgggtggactgagggatcccatggattac
ccccgggcccttgccttgggaggggatctggccgcagccgcacttcccttcatccggctg
gcccgcagcggcggagctgcagctgtggaatcatatctggacgaaattttcctcacactc
cggagaaccatgcttcttaccggcagcgccaccatccatgagctgaagcaagcgcccctg
ctgatcgacccggacttcagcagatacagcgagcagctgctgcaaacggcccggcagtct
gcgggaacgcaccgggggcagcagccccatatctcccgggaaaaaacccctccggaaccc
cctccggaaacatccccggaaacatccccggaaacatccccggaaacatctccggaaaga
tccccggccctgaatgaccgtaaattccgaaaatacaatatccaccggagaagacggatg
cttgccaacgatccggtgctgaacctggacagggaagcggtgaatgccggaggacattcc
gacagcatgctggatcttgcggatgtgatggtggaatccgcagtgggattcatgcccgta
cccatgggaattgccaagggcttcctgatagacggcaggcttcaccacctgcctctctcg
gtggaagagccttcggtgatcgcggcggcaagctacgccgcaggaataattgcaaggaac
ggcgggtttgaaacctccgcagatgaaccgctgatgagcgcgtatatttatcttgatatt
tcatcccggtcaggcgatccctccccggaagccattcgctcagctctgaagtcggtaaaa
gatgaagagcagcggctgaaagatctgctgtcaccggtacttgaatccatgacacggcga
ggcggaggataccgcagcatggaagcttcatggcttgaagaaagccggacgctccgggtg
gagctcaccctggatgtccgggacgccatgggggcaaatatcctcaacaccgcagcagaa
accatctctcctctgctggaagagataaccggcggtgagaaactcatggccattctcagc
aacgatgcggtaaaacgcagggccaaagcccggtttgcaatccccttcaccgccctcagc
agaggaaaatacagcggaagagagcttgcagagcgcatcgtgaaactctatgaaatagcc
gatgaagatccgtcacgggcggtaacccataacaaggggattatgaacggtatctccagc
cttgcccttgcaaccgcaaacgatacacgggccaccgaggccgccgcccatgcctgggct
gccaggagcgggcgctaccggagcttaagcgtgttccgcattgagggtgaccggctggtg
ggcgaactggagctgccactggcactgggcaccgtcgggggagggatctccttccatccg
gcggcccggttcgccctggatatcctgggaaaacccgatgctcccgccctttcacggatg
gctgcagccctgggactggcccagaacttcgccgccatatcggcccttgccggggaggga
attcagaaagggcacatgaaactgcattcaggacgtcttgcatataaagccggagcccgg
ggggacagcatccccctccttgtggaaaaaattcagcagtcaggcgtatacaatatggag
caggcccgtcggctgctcgaagagattggcaggaacagataa

DBGET integrated database retrieval system