KEGG   Streptomyces lincolnensis: SLINC_4366Help
Entry
SLINC_4366        CDS       T04801                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00450  Selenocompound metabolism
sls00970  Aminoacyl-tRNA biosynthesis
sls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SLINC_4366
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SLINC_4366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sls01007]
    SLINC_4366
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sls03016]
    SLINC_4366
Enzymes [BR:sls01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SLINC_4366
Amino acid related enzymes [BR:sls01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SLINC_4366
Transfer RNA biogenesis [BR:sls03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SLINC_4366
 Prokaryotic type
   Other AARSs
    SLINC_4366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ANS66590
UniProt: A0A1B1MD76
Position
complement(5203577..5205301)
Genome map
AA seq 574 aa AA seqDB search
MARHLITSALPYINGIKHLGNMVGSMLPADVYSRYLRQRGHDVLYICATDEHGTPAELAA
KEQGLPVDEFCAQSHDAQKAVYDGFELAFDYFGRSSSPQNAELTQHFARKLNENGFIEER
AIRQVYSPADGRFLPDRYVEGTCPHCGYDKARGDQCENCTRVLDPTDLIDPRSAISGSTD
LEVRETKHLFLLQSKLQHEVEAWVAAHEEEWPQLASSIARKWLNEGLHDRAITRDLDWGV
PVPADTWPELAAEGKVFYVWFDAPIEYIGATKEWADQDPENRDWKSWWYEADSGEDPVRY
TEFMAKDNVPFHTVMFPATEIGVREPWKKVDYVKAFNWLTYYGGKFSTSQKRGVFTDQAL
AILPADYWRYFLIANAPESDDSSFTWEHFTATVNKDLADTLGNFVNRVLSFSRKRFGDEV
PAGGEPGEAETRLGEQIAELLAEYESQMESLQFRKAAAALRALWSAGNSYLEEKAPWLQI
KTDQDGAALTLRTAMNLIHLYAVVSEPFIPASSAAMRQAFTLKDDNATWISPTEAKSLTT
VAPGTPFTVPPVLFAKLTDEDLETYKERFGGEPA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacacctcatcaccagcgcccttccgtacatcaacgggatcaagcacctgggc
aacatggtggggtccatgctcccggcggacgtgtactcccggtacctccgccagcgcggc
cacgacgtcctctacatctgcgcgacggacgaacacggcaccccggccgaactggcggcg
aaggagcagggcctcccggtcgacgagttctgcgcgcagtcgcacgacgcgcagaaggcg
gtctacgacggcttcgagctggccttcgactacttcggccgcagttccagcccgcagaac
gccgaactgacgcagcacttcgcccgcaagctgaacgagaacgggttcatcgaggagcgc
gcgatccgccaggtgtacagcccggcggacggccgcttcctcccggaccgctatgtcgag
ggcacctgcccccactgcggctacgacaaggcccgcggcgaccagtgcgagaactgcacg
cgcgtcctggaccccacggatctgatcgacccgcgctcggcgatctcgggcagcacggac
ctcgaagtgcgggagaccaagcacctcttcctcctccagtccaagctccagcacgaggtc
gaggcgtgggtggcggcccacgaggaggagtggccgcagctggcgtcctcgatcgcccgc
aagtggctgaacgagggcctgcacgaccgcgcgatcacccgcgacctggactggggcgtc
ccggtcccggccgacacctggccggagctcgcggccgagggcaaggtgttctacgtctgg
ttcgacgccccgatcgagtacatcggcgcgacgaaggagtgggcggaccaggacccggag
aacagggactggaagtcctggtggtacgaggcggactcgggcgaggaccccgtccgctac
accgagttcatggcgaaggacaacgtcccgttccacacggtgatgttcccggccacggag
atcggcgtacgcgagccgtggaagaaggtcgactacgtcaaggccttcaactggctgacg
tactacggcggaaagttctcgacctcgcagaagcggggcgtcttcaccgaccaggccctc
gccatcctcccggccgactactggcgctacttcctcatcgccaacgccccggagtcggac
gactcgtccttcacctgggagcacttcacggccacggtgaacaaggacctggccgacacc
ctcggcaacttcgtcaaccgcgtgctgtccttctccaggaagcgcttcggcgacgaggtc
cccgcgggcggcgagccgggcgaggcggagacgcggctcggcgagcagatcgccgagctc
ctcgccgagtacgagtcccagatggagtccctccagttccgcaaggcggcggcggccctg
cgcgccctgtggtcggccggcaactcctacctggaggagaaggccccctggctccagatc
aagaccgaccaggacggcgcggccctcaccctgcgcacggcgatgaacctgatccacctc
tacgcggtggtctcggaacccttcatcccggcctcctctgcggccatgcgccaggccttc
accctgaaggacgacaacgcgacctggatctccccgaccgaggccaaatccctcaccacc
gtcgcccccggcacccccttcaccgtccccccggtcctcttcgccaagctgacggacgag
gacctggagacgtacaaggaacgcttcggcggcgaacccgcgtaa

DBGET integrated database retrieval system