KEGG   Streptomyces lincolnensis: SLINC_5099
Entry
SLINC_5099        CDS       T04801                                 

Definition
(GenBank) 2-epi-5-epi-valiolone-7-phosphate 2-epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00525  Acarbose and validamycin biosynthesis
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SLINC_5099
Enzymes [BR:sls01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     SLINC_5099
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ANS67323
UniProt: A0A1B1MFN2
Position
complement(6064529..6065428)
AA seq 299 aa
MTTPGITAPGTPPPAPVVALTSWRLPVAGAEEAVRCAARLAADGVQLDLGGPGRGPRADA
PGTVAATLRASAETGVALLGLTANTLNDIGLTARPDSADATLARAVVVRALDAARELGVP
LVFLPSFRRSAVESPDDFRRTARILSWAAEEAAARGLTLASENVLAAPRARALAEEVGSP
AFRLLLDPYNLCAAGHDPVRWVVAVGPHLADQIHLKDGHAGVPASAPLGAGEGRLTEVLD
AVAAFGPVPRALVLENDYRETGHHGGEFDLPLRDLAWARARAASFAPHPEPLDPNEAAV
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaccacgcccggcatcaccgcgcccggcacgccgcccccggccccggtcgtcgccctc
acctcctggcggctgcccgtggcgggcgcagaggaggcggtgcggtgtgcggcacggctc
gcggccgacggggtgcagctcgacctcggcgggccggggcgcggtccccgggccgacgcc
cccggcacggtcgcggccacgctccgggcgagcgccgagaccggtgtcgccctgctcggg
ctgaccgccaacacgctcaacgacatcggactcacggcccgtccggacagcgccgatgcc
accctggccagggcggtggtcgtacgagcgctggacgcggcccgtgagctgggcgtaccg
ctggtgttcctgcccagcttccggcgcagcgccgtcgagagtccggacgacttccggcgc
accgcccggatcctgtcctgggccgccgaggaggccgccgcccgcgggctgacgctcgcg
agcgagaacgtcctggcggctccccgggcgagggcgctggccgaggaggtcggctcgccg
gccttccggctgctcctcgacccgtacaacctgtgcgcggccgggcacgacccggtgcgc
tgggtggtggccgtcgggccgcacctcgccgaccagatccatctcaaggacggtcacgcc
ggggtgccggcgagcgcccccctcggcgccggcgagggccgcctgacggaggtgctcgac
gccgtggccgcgttcggccccgtcccgcgcgcgctggtcctggagaacgactaccgggag
accggccaccacggcggggagttcgacctcccgctccgcgatctcgcctgggcgcgggcc
cgtgccgcgagcttcgcaccgcaccccgaaccactcgacccgaatgaggcagccgtatga

DBGET integrated database retrieval system