KEGG   Streptomyces lincolnensis: SLINC_5614Help
Entry
SLINC_5614        CDS       T04801                                 

Definition
(GenBank) lyase
  KO
K10156  epi-isozizaene synthase [EC:4.2.3.37]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00909  Sesquiterpenoid and triterpenoid biosynthesis
sls01110  Biosynthesis of secondary metabolites
sls01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SLINC_5614
Enzymes [BR:sls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.37  epi-isozizaene synthase
     SLINC_5614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: ANS67838
UniProt: A0A1B1MGW3
Position
6681108..6682193
Genome map
AA seq 361 aa AA seqDB search
MPAFPHSTTSTPTAIAVPPSLALPVIEAAFPRRLHPYWPRLQEKTRTWLLEMRLMPADKV
AEYADGLCYTDLMAGYYLGAPDEVLQAIADYSAWFFVWDDRHDRDIVHRRPAAWRRLRFR
LHAALESPRTHLHHEDPLVAGFADSVLRLYSFLPQSWNRRFARHFHQVIDAYDREFRNRT
EGVIPKVDEYLALRRLTFAHWIWTDLLEPSAGLELPNSVRKHPTYRRAALLSQEFAAWYN
DLCSLPKEIAGDEVHNLGISLIKHEGLTLEEAVADMRRRVEKCVEEFLVVERDALRLSDD
LDDGTVRGKELGTAVRACVRNMRNWFSTVYWFHHESGRYRVDSWDDRSTPPYVNNEAAGE
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgctttcccacacagcaccacatcgacgccgacggcgatcgcggtcccaccctcg
ctcgctcttccggtgatcgaggctgcgtttccccggcgactgcacccgtattggccccgg
ctccaggagaagacccgaacctggcttctggaaatgcggctcatgcccgccgacaaggtg
gccgaatatgccgacggtctgtgctatacggacctcatggcggggtactacttgggcgcc
cccgacgaggtcctccaggcgatcgcggactacagcgcgtggttcttcgtctgggacgac
cgtcacgaccgcgacatcgtgcaccggcgcccggccgcctggcggcggctgaggttccgg
ctccacgcggccctcgaatcaccccggacccacctgcaccacgaggatccgctggtcgcc
gggttcgcggacagcgtgctgcggctgtactcgttcctgccgcagtcgtggaaccggcgg
ttcgcccggcacttccaccaggtgatcgacgcctacgaccgggaattcaggaaccgcacc
gagggagtcatcccgaaggtcgatgaatacctggcgctgcgtcggctcaccttcgcccac
tggatctggaccgatctgctggaacccagcgcgggactggaactcccgaactccgtgcgg
aaacacccgacataccggcgggccgcactgctgagtcaggaattcgccgcctggtacaac
gacctctgttcgctacccaaagaaatagcgggcgacgaggtccacaatctcggaatcagt
ctcatcaagcacgaggggctgaccctggaggaagccgtcgccgacatgaggcggcgcgtg
gagaaatgcgtcgaggaattccttgtcgtggagcgggacgccctgcggctttccgacgat
ctcgacgacggaaccgtgcgcggaaaagaactcggcaccgccgtgcgcgcctgcgtccgc
aacatgcggaactggttcagcaccgtctactggttccaccacgagtccggccggtaccgg
gtcgacagctgggacgaccggtccactcccccgtacgtcaacaacgaagcggcaggtgag
aaatga

DBGET integrated database retrieval system